PSMA3 Picoband polyclonal, anti-human, mouse, rat
€455.00
In stock
SKU
AC-ABO11707
Catalog Number: AC-ABO11707
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB, IHC-P
Datasheet
Request Information
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB, IHC-P
Datasheet
Request Information
Description: Rabbit IgG polyclonal antibody for Proteasome subunit alpha type-3(PSMA3) detection. Tested with WB, IHC-P in Human;Mouse;Rat.Protein Name: Proteasome subunit alpha type-3
Protein Function:
The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity. Binds to the C-terminus of CDKN1A and thereby mediates its degradation. Negatively regulates the membrane trafficking of the cell-surface thromboxane A2 receptor (TBXA2R) isoform 2. .
Other Names: Proteasome subunit alpha type-3, 3.4.25.1, Macropain subunit C8, Multicatalytic endopeptidase complex subunit C8, Proteasome component C8, PSMA3, HC8, PSC8
Subcellular Localization: Cytoplasm. Nucleus.
Gene ID: 5684
Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human PSMA3 (88-127aa LADIAREEASNFRSNFGYNIPLKHLADRVAMYVHAYTLYS), identical to the related mouse and rat sequences.
Calculated MW: 28433
Purification: Immunogen affinity purified.
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
Protein Function:
The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity. Binds to the C-terminus of CDKN1A and thereby mediates its degradation. Negatively regulates the membrane trafficking of the cell-surface thromboxane A2 receptor (TBXA2R) isoform 2. .
Other Names: Proteasome subunit alpha type-3, 3.4.25.1, Macropain subunit C8, Multicatalytic endopeptidase complex subunit C8, Proteasome component C8, PSMA3, HC8, PSC8
Subcellular Localization: Cytoplasm. Nucleus.
Gene ID: 5684
Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human PSMA3 (88-127aa LADIAREEASNFRSNFGYNIPLKHLADRVAMYVHAYTLYS), identical to the related mouse and rat sequences.
Calculated MW: 28433
Purification: Immunogen affinity purified.
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
| Is Featured? | No |
|---|
Write Your Own Review