PSMA4 Picoband polyclonal, anti-human, mouse, rat
€455.00
In stock
SKU
AC-ABO11708
Catalog Number: AC-ABO11708
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB
Datasheet
Request Information
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB
Datasheet
Request Information
Description: Rabbit IgG polyclonal antibody for Proteasome subunit alpha type-4(PSMA4) detection. Tested with WB in Human;Mouse;Rat.Protein Name: Proteasome subunit alpha type-4
Protein Function:
The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity.
Other Names: Proteasome subunit alpha type-4, 3.4.25.1, Macropain subunit C9, Multicatalytic endopeptidase complex subunit C9, Proteasome component C9, Proteasome subunit L, PSMA4, HC9, PSC9
Subcellular Localization: Cytoplasm. Nucleus. Cytoplasm, P-body . Colocalizes with TRIM5 in the cytoplasmic bodies. .
Gene ID: 5685
Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human PSMA4 (84-123aa NVLTNELRLIAQRYLLQYQEPIPCEQLVTALCDIKQAYTQ), identical to the related mouse and rat sequences.
Calculated MW: 29484
Purification: Immunogen affinity purified.
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
Protein Function:
The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity.
Other Names: Proteasome subunit alpha type-4, 3.4.25.1, Macropain subunit C9, Multicatalytic endopeptidase complex subunit C9, Proteasome component C9, Proteasome subunit L, PSMA4, HC9, PSC9
Subcellular Localization: Cytoplasm. Nucleus. Cytoplasm, P-body . Colocalizes with TRIM5 in the cytoplasmic bodies. .
Gene ID: 5685
Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human PSMA4 (84-123aa NVLTNELRLIAQRYLLQYQEPIPCEQLVTALCDIKQAYTQ), identical to the related mouse and rat sequences.
Calculated MW: 29484
Purification: Immunogen affinity purified.
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
| Is Featured? | No |
|---|
Write Your Own Review