PTGER4 Picoband polyclonal, anti-human
€455.00
In stock
SKU
AC-ABO10231
Catalog Number: AC-ABO10231
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB
Datasheet
Request Information
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB
Datasheet
Request Information
Description: Rabbit IgG polyclonal antibody for Prostaglandin E2 receptor EP4 subtype(PTGER4) detection. Tested with WB in Human.Protein Name: Prostaglandin E2 receptor EP4 subtype
Protein Function:
Receptor for prostaglandin E2 (PGE2). The activity of this receptor is mediated by G(s) proteins that stimulate adenylate cyclase. Has a relaxing effect on smooth muscle. May play an important role in regulating renal hemodynamics, intestinal epithelial transport, adrenal aldosterone secretion, and uterine function.
Other Names: Prostaglandin E2 receptor EP4 subtype, PGE receptor EP4 subtype, PGE2 receptor EP4 subtype, Prostanoid EP4 receptor, PTGER4, PTGER2
Subcellular Localization: Cell membrane; Multi-pass membrane protein.
Tissue Specificity: High in intestine and in peripheral blood mononuclear cells; low in lung, kidney, thymus, uterus, vasculature and brain. Not found in liver, heart, retina oe skeletal muscle.
Gene ID: 5734
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human PTGER4 (311-345aa DLQAIRIASVNPILDPWIYILLRKTVLSKAIEKIK), identical to the related mouse and rat sequences.
Calculated MW: 53119
Purification: Immunogen affinity purified.
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
Protein Function:
Receptor for prostaglandin E2 (PGE2). The activity of this receptor is mediated by G(s) proteins that stimulate adenylate cyclase. Has a relaxing effect on smooth muscle. May play an important role in regulating renal hemodynamics, intestinal epithelial transport, adrenal aldosterone secretion, and uterine function.
Other Names: Prostaglandin E2 receptor EP4 subtype, PGE receptor EP4 subtype, PGE2 receptor EP4 subtype, Prostanoid EP4 receptor, PTGER4, PTGER2
Subcellular Localization: Cell membrane; Multi-pass membrane protein.
Tissue Specificity: High in intestine and in peripheral blood mononuclear cells; low in lung, kidney, thymus, uterus, vasculature and brain. Not found in liver, heart, retina oe skeletal muscle.
Gene ID: 5734
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human PTGER4 (311-345aa DLQAIRIASVNPILDPWIYILLRKTVLSKAIEKIK), identical to the related mouse and rat sequences.
Calculated MW: 53119
Purification: Immunogen affinity purified.
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
| Is Featured? | No |
|---|
Write Your Own Review