PTP4A2 Picoband polyclonal, anti-human, mouse, rat
€455.00
In stock
SKU
AC-ABO12426
Catalog Number: AC-ABO12426
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB, IHC-P
Datasheet
Request Information
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB, IHC-P
Datasheet
Request Information
Description: Rabbit IgG polyclonal antibody for Protein tyrosine phosphatase type IVA 2(PTP4A2) detection. Tested with WB, IHC-P in Human;Mouse;Rat.Protein Name: Protein tyrosine phosphatase type IVA 2
Protein Function:
Protein tyrosine phosphatase which stimulates progression from G1 into S phase during mitosis. Promotes tumors. Inhibits geranylgeranyl transferase type II activity by blocking the association between RABGGTA and RABGGTB. .
Other Names: Protein tyrosine phosphatase type IVA 2, 3.1.3.48, HU-PP-1, OV-1, PTP(CAAXII), Protein-tyrosine phosphatase 4a2, Protein-tyrosine phosphatase of regenerating liver 2, PRL-2, PTP4A2, PRL2, PTPCAAX2
Subcellular Localization: Cell membrane. Early endosome. Cytoplasm.
Tissue Specificity: Ubiquitously expressed, with highest levels in skeletal muscle, heart and thymus. Overexpressed in prostate tumor tissue. .
Gene ID: 8073
Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human PTP4A2 (40-69aa TTLVRVCDATYDKAPVEKEGIHVLDWPFDD), identical to the related mouse and rat sequences.
Calculated MW: 19127
Purification: Immunogen affinity purified.
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
Protein Function:
Protein tyrosine phosphatase which stimulates progression from G1 into S phase during mitosis. Promotes tumors. Inhibits geranylgeranyl transferase type II activity by blocking the association between RABGGTA and RABGGTB. .
Other Names: Protein tyrosine phosphatase type IVA 2, 3.1.3.48, HU-PP-1, OV-1, PTP(CAAXII), Protein-tyrosine phosphatase 4a2, Protein-tyrosine phosphatase of regenerating liver 2, PRL-2, PTP4A2, PRL2, PTPCAAX2
Subcellular Localization: Cell membrane. Early endosome. Cytoplasm.
Tissue Specificity: Ubiquitously expressed, with highest levels in skeletal muscle, heart and thymus. Overexpressed in prostate tumor tissue. .
Gene ID: 8073
Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human PTP4A2 (40-69aa TTLVRVCDATYDKAPVEKEGIHVLDWPFDD), identical to the related mouse and rat sequences.
Calculated MW: 19127
Purification: Immunogen affinity purified.
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
| Is Featured? | No |
|---|
Write Your Own Review