PTP4A2 polyclonal, anti-human, mouse, rat

Quantity: 100 µg

Background:
Protein tyrosine phosphatase type IVA 2 is an enzyme that in humans is encoded by the PTP4A2 gene. The protein encoded by this gene belongs to a small class of the protein tyrosine phosphatase (PTP) family. PTPs are cell signaling molecules that play regulatory roles in a variety of cellular processes. PTPs in this class contain a protein tyrosine phosphatase catalytic domain and a characteristic C-terminal prenylation motif. This PTP has been shown to primarily associate with plasmic and endosomal membrane through its C-terminal prenylation. This PTP was found to interact with the beta-subunit of Rab geranylgeranyltransferase II (beta GGT II), and thus may function as a regulator of GGT II activity. Overexpression of this gene in mammalian cells conferred a transformed phenotype, which suggested its role in tumorigenesis. Alternatively spliced transcript variants have been described. Related pseudogenes exist on chromosomes 11, 12 and 17.

Description:
Rabbit IgG polyclonal antibody for Protein tyrosine phosphatase type IVA 2 (PTP4A2) detection. Tested with WB, IHC-P in Human, Mouse, Rat.

Synonyms:
BM 008 antibody, EC 3.1.3.48 antibody, HH 13 antibody, HH13 antibody, HH7 2 antibody, HU PP 1 antibody, HUPP 1 antibody, HUPP1 antibody, OV 1 antibody, OV1 antibody, phosphatase of regenerating liver 2 antibody, PRL 2 antibody, PRL2 antibody, Protein tyrosine phosphatase 4a2 antibody, protein tyrosine phosphatase IVA antibody, protein tyrosine phosphatase IVA2 antibody, Protein tyrosine phosphatase of regenerating liver 2 antibody, protein tyrosine phosphatase type IVA 2 antibody, Protein tyrosine phosphatase type IVA member 2 isoform 1 antibody, protein tyrosine phosphatase type IVA, member 2 antibody, PTP (CAAXII) antibody, ptp IV1a antibody, ptp IV1b antibody, PTP4A antibody, PTPCAAX2 antibody, TP4A2_HUMAN antibody

Isotype: Rabbit polyclonal IgG

Immunogen:
A synthetic peptide corresponding to a sequence at the N-terminus of human PTP4A2 (40-69aa TTLVRVCDATYDKAPVEKEGIHVLDWPFDD), identical to the related mouse and rat sequences.

Form: Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Specificity:
No cross reactivity with other proteins.

Reactivity: Reacts with: human, mouse, rat

Applications: WB, IHC-P

Reconstitution:
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.