PTPN22 Picoband polyclonal, anti-human, rat antibody
€310.00
In stock
SKU
AC-ABO12470
Description: Rabbit IgG polyclonal antibody for Transmembrane protein 107 (TMEM107) detection. Tested with WB, IHC-P in human.
Protein Name: Transmembrane protein 107
Background:
Plays a role in cilia formation and embryonic patterning. Requires for normal Sonic hedgehog (Shh) signaling in the neural tube and acts in combination with GLI2 and GLI3 to pattern ventral and intermediate neuronal cell types (By similarity). .
Other Names:
Transmembrane protein 107, TMEM107
Subcellular Localization: Membrane ; Multi-pass membrane protein .
Gene ID: 84314
Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human TMEM107 (22-57aa VITLFWSRDSNIQACLPLTFTPEEYDKQDIQLVAAL), different from the related mouse and rat sequences by four amino acids.
Calculated MW: 15503
Purification: Immunogen affinity purified.
Format: Lyophilized
Contents: Each vial contains 5mg BSA, 0.9 mg NaCl, 0.2mg Na2HPO4, 0.05 mg NaN3.
Concentration (mg/ml): Add 0.2 ml of distilled water will yield a concentration of 500 µg/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.
Protein Name: Transmembrane protein 107
Background:
Plays a role in cilia formation and embryonic patterning. Requires for normal Sonic hedgehog (Shh) signaling in the neural tube and acts in combination with GLI2 and GLI3 to pattern ventral and intermediate neuronal cell types (By similarity). .
Other Names:
Transmembrane protein 107, TMEM107
Subcellular Localization: Membrane ; Multi-pass membrane protein .
Gene ID: 84314
Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human TMEM107 (22-57aa VITLFWSRDSNIQACLPLTFTPEEYDKQDIQLVAAL), different from the related mouse and rat sequences by four amino acids.
Calculated MW: 15503
Purification: Immunogen affinity purified.
Format: Lyophilized
Contents: Each vial contains 5mg BSA, 0.9 mg NaCl, 0.2mg Na2HPO4, 0.05 mg NaN3.
Concentration (mg/ml): Add 0.2 ml of distilled water will yield a concentration of 500 µg/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.
| Is Featured? | No |
|---|
Write Your Own Review