PTPN22 polyclonal, anti-human, rat

Quantity: 100 µg

Background:
Protein tyrosine phosphatase, non-receptor type 22 (lymphoid), also known as PTPN22, is a protein that in humans is encoded by the PTPN22 gene. This gene encodes of member of the non-receptor class 4 subfamily of the protein-tyrosine phosphatase family. The encoded protein is a lymphoid-specific intracellular phosphatase that associates with the molecular adapter protein CBL and may be involved in regulating CBL function in the T-cell receptor signaling pathway. Mutations in this gene may be associated with a range of autoimmune disorders including Type 1 Diabetes, rheumatoid arthritis, systemic lupus erythematosus and Graves' disease. Alternatively spliced transcript variants encoding distinct isoforms have been described.

Description:
Rabbit IgG polyclonal antibody for Tyrosine-protein phosphatase non-receptor type 22 (PTPN22) detection. Tested with WB in Human, Rat.

Synonyms:
Hematopoietic cell protein tyrosine phosphatase 70Z PEP antibody, Hematopoietic cell protein-tyrosine phosphatase 70Z-PEP antibody, Lymphoid phosphatase antibody, Lymphoid specific protein tyrosine phosphatase antibody, lymphoid-specific, inducible human protein tyrosine phosphatase antibody, Lyp 1 antibody, Lyp 2 antibody, LyP antibody, Lyp1 antibody, Lyp2 antibody, LyPTP antibody, OTTHUMP00000013720 antibody, OTTHUMP00000013721 antibody, OTTHUMP00000233450 antibody, OTTHUMP00000233451 antibody, PEP antibody, PEST-domain phosphatase antibody, Protein tyrosine phosphatase non receptor type 22 (lymphoid) antibody, Protein tyrosine phosphatase non receptor type 22 antibody, Protein tyrosine phosphatase non receptor type 8 antibody, Protein tyrosine phosphatase non receptor type 8, formerly antibody, PTN22_HUMAN antibody, PTPN 22 antibody, PTPN 8 antibody, Ptpn22 antibody, PTPN8 antibody, PTPN8, formerly antibody, Tyrosine-protein phosphatase non-receptor type 22 antibody

Isotype: Rabbit polyclonal IgG

Immunogen:
A synthetic peptide corresponding to a sequence at the N-terminus of human PTPN22 (1-42aa MDQREILQKFLDEAQSKKITKEEFANEFLKLKRQSTKYKADK), different from the related mouse sequence by eight amino acids.A synthetic peptide corresponding to a sequence at the N-terminus of human PTPN22 (1-42aa MDQREILQKFLDEAQSKKITKEEFANEFLKLKRQSTKYKADK), different from the related mouse sequence by eight amino acids.

Form: Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Specificity:
No cross reactivity with other proteins.

Reactivity: Reacts with: human, rat

Applications: WB

Reconstitution:
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.