Tissue Factor human active recombinant protein

Protein Family: Immune System

Pathway and Disease: Cell Adhesion Molecules

Alternate Names: Tissue Factor, Coagulation Factor III, TF, Tissue Thromboplastin, CD142Description:
Tissue factor is best known as the primary cellular initiator of blood coagulation. After vessel injury, the tissue factor : Factor VIIa complex activates the coagulation protease cascade, which leads to fibrin deposition and activation of platelets. Aberrant tissue factor expression within the vasculature initiates life threatening thrombosis in various diseases, such as sepsis, atherosclerosis, and cancer. Recombinant tissue factor comprises a 219 amino acid fragment (33-251) corresponding to the extracellular domain of tissue factor protein and is expressed in E. coli with an amino-terminal hexahistidine tag.

Source: E. coli

Applications: E, WB

Accession No.: P13726

MW: 29.3 kDa

Sequence:
His-Tag sequence not included: SGTTNTVAAYNLTWKSTNFKTILEWEPKPVNQVYTVQISTKSGDWKSKCFYTTDTECDLTDEIVKDVKQTYLARVFSYPAGNVESTGSAGEPLYENSPEFTPYLETNLGQPTIQSFEQVGTKVNVTVEDERTLVRRNNTFLSLRDVFGKDLIYTLYYWKSSSSGKKTAKTNTNEFLIDVDKGENYCFSVQAVIPSRTVNRKSTDSPVECMGQEKGEFRE

Purity:
Purity > 95% as determined by reducing and non-reducing SDS-PAGE, Bradford assay, Western blot and ELISA.

Format:
Each vial contains 0.01 mg protein (liquid) in PBS pH7.4, 50% glycerol. Final concentration 0.1-1 mg/ml.

Storage: Store at -20°C. Product is guaranteed one year from the date of shipment.