TNF-R1 human active recombinant protein

TNF-R1 human active recombinant protein

€295.00
In stock
SKU
600299
Catalog Number: 600299
Size: 0.01 mg
Datasheet
Request Information
Protein Family: Cellular Antigens, Receptors and Channels

Pathway and Disease: ignal Transduction, Infectious Diseases, Signaling Molecules and Interaction, Cell Growth and Death, Endocrine System, Neurodegenerative Disorders

Alternate Names: TNF-R1, Soluble tumour necrosis factor receptor-1, TNF-R1 Tumour necrosis factor receptor subfamily member 1A (TNFRSF1A), Tumour necrosis factor binding protein I (TNFBPI), Tumour necrosis factor receptor type I (TNFRI), Tumour necrosis factor-alpha receptor (TNFAR), CD120a antigen, p55, p55-R, p60, MGC19588Description:
Two types of soluble TNF receptors (sTNF-R1 and sTNF-R2) have been identified which act to neutralize the biological activities of TNF alpha and TNF beta. Levels of these soluble receptors appear to arise as a result of shedding of the extracellular domains of the membrane bound receptors. Elevated levels of soluble TNF receptors have been found in the amniotic fluid of pregnant women. Recombinant sTNF-R1 comprises a 161 amino acid fragment (41-201) corresponding to the mature TNF-R1 protein and is expressed in E. coli with an amino-terminal hexahistidine tag.

Source: E. coli

Applications: E, WB

Accession No.: P19438

MW: 22.68 kDa

Sequence:
His-Tag sequence not included: DSVCPQGKYIHPQNNSICCTKCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVDRDTVCGCRKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENECVSCSNCKKSLECTKLCLPQIEN

Purity:
Purity > 95% as determined by reducing and non-reducing SDS-PAGE, Bradford assay, Western blot and ELISA.

Format:
Each vial contains 0.01 mg protein (liquid) in PBS pH7.4, 50% glycerol. Final concentration 0.1-1 mg/ml.

Storage: Store at -20°C. Product is guaranteed one year from the date of shipment.
More Information
Is Featured? No
Write Your Own Review
You're reviewing:TNF-R1 human active recombinant protein