VEGF-165 human active recombinant protein

Protein Family: Cytokines, CAM Ligands,

Pathway and Disease: Signaling Molecules and Interaction, Cancers, Cell Communication

Alternate Names: VEGF-A, Vascular endothelial growth factor, VEGFA, VEGF-A, Glioma-derived growth endothelial growth factor (GD-VEGF), Vasculotrophin (VAS), Vascular endothelial cell proliferation factor, Vascular permeability factor (VPF)Description:
Vascular Endothelial Growth Factor (VEGF) is a heparin-binding glycoprotein which can exist in a number of different isoforms. The protein has been found to be a potent inducer of angiogeneis and endothelial cell proliferation, and plays an important role in regulating vasculogenesis. VEGF can be detected in both the plasma and serum and has been implicated in several disease states associated with augmented angiogenesis. Recombinant VEGF-165 comprises a 165 amino acid fragment (5-169) corresponding to the VEGF 165 isoform and is expressed in E. coli with an amino-terminal hexahistidine tag.

Source: E. coli

Applications: E, WB

Accession No.: P15692

MW: 23.63 kDa

Sequence:
His-Tag sequence not included: APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPPQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR

Purity:
Purity > 95% as determined by reducing and non-reducing SDS-PAGE, Bradford assay, Western blot and ELISA.

Format:
Each vial contains 0.01 mg protein (liquid) in PBS pH7.4, 50% glycerol. Final concentration 0.1-1 mg/ml.

Storage: Store at -20°C. Product is guaranteed one year from the date of shipment.