VEGFR-1 human active recombinant protein

Protein Family: Enzymes, Transporters, Protein Kinases, Receptors and Channels

Pathway and Disease: Signaling Molecules and Interaction, Cell Communication

Alternate Names: VEGFR-1, Vascular endothelial growth factor receptor-1 [precursor], VEGFR-1, EC 2.7.1.112, Vascular permeability factor receptor, Tyrosine-protein kinase receptor FLT, FLT-1, Tyrosine-protein kinase FRT, FMS-like tyrosine kinase 1Description:
Vascular Endothelial Growth Factor Receptor-1 (VEGFR-1) belongs to a family of five receptor tyrosine kinase receptors that are specific to a number of angiogenic factors including VEGF and PDGF, and are therefore thought to play a role in the angiogenic process. VEGFR-1 is expressed in two forms, predominantly on endothelial cells, giving rise to a full-length membrane bound receptor and a truncated soluble receptor. Elevated levels of the soluble form of this VEGF receptor are used in the diagnosis of pathological conditions. Recombinant VEGFR-1 comprises a 298 amino acid fragment (31-328) corresponding to the IgG-like domains 1-3 from the mature soluble VEGFR protein. VEGF-R1 is expressed in E. coli with an amino-terminal hexahistidine tag.

Source: E. coli

Applications: E, WB

Accession No.: P17948

MW: 38.16 kDa

Sequence:
His-Tag sequence not included: SLKGTQHIMQAGQTLHLQCRGEAAHKWSLPEMVSKESERLSITKSACGRNGKQFCSTLTLNTAQANHTGFYSCKYLAVPTSKKKETESAIYIFISDTGRPFVEMYSEIPEIIHMTEGRELVIPCRVTSPNITVTLKKFPLDTLIPDGKRIIWDSRKGFIISNATYKEIGLLTCEATVNGHLYKTNYLTHRQTNTIIDVQISTPRPVKLLRGHTLVLNCTATTPLNTRVQMTWSYPDEKNKRASVRRRIDQSNSHANIFYSVLTIDKMQNKDKGLYTCRVRSGPSFKSVNTSVHI

Purity:
Purity > 95% as determined by reducing and non-reducing SDS-PAGE, Bradford assay, Western blot and ELISA.

Format:
Each vial contains 0.01 mg protein (liquid) in PBS pH7.4, 50% glycerol. Final concentration 0.1-1 mg/ml.

Storage: Store at -20°C. Product is guaranteed one year from the date of shipment.