Cofilin 2 polyclonal, anti-human, mouse, rat
€455.00
In stock
SKU
AC-ABO12783
Catalog Number: AC-ABO12783
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB, IHC-P
Datasheet
Request Information
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB, IHC-P
Datasheet
Request Information
Description: Rabbit IgG polyclonal antibody for Cofilin-2(CFL2) detection. Tested with WB, IHC-P in Human;Mouse;Rat.Protein Name: Cofilin-2
Protein Function:
Controls reversibly actin polymerization and depolymerization in a pH-sensitive manner. Its F-actin depolymerization activity is regulated by association with CSPR3 (PubMed:19752190). It has the ability to bind G- and F-actin in a 1:1 ratio of cofilin to actin. It is the major component of intranuclear and cytoplasmic actin rods. Required for muscle maintenance. May play a role during the exchange of alpha-actin forms during the early postnatal remodeling of the sarcomere (By similarity). .
Other Names: Cofilin-2, Cofilin, muscle isoform, CFL2
Subcellular Localization: Nucleus matrix . Cytoplasm, cytoskeleton . Colocalizes with CSPR3 in the Z line of sarcomeres. .
Tissue Specificity: Isoform CFL2b is expressed predominantly in skeletal muscle and heart. Isoform CFL2a is expressed in various tissues.
Gene ID: 1073
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Cofilin 2 (121-153aa KDAIKKKFTGIKHEWQVNGLDDIKDRSTLGEKL), identical to the related mouse sequence.
Calculated MW: 18737
Purification: Immunogen affinity purified.
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
Protein Function:
Controls reversibly actin polymerization and depolymerization in a pH-sensitive manner. Its F-actin depolymerization activity is regulated by association with CSPR3 (PubMed:19752190). It has the ability to bind G- and F-actin in a 1:1 ratio of cofilin to actin. It is the major component of intranuclear and cytoplasmic actin rods. Required for muscle maintenance. May play a role during the exchange of alpha-actin forms during the early postnatal remodeling of the sarcomere (By similarity). .
Other Names: Cofilin-2, Cofilin, muscle isoform, CFL2
Subcellular Localization: Nucleus matrix . Cytoplasm, cytoskeleton . Colocalizes with CSPR3 in the Z line of sarcomeres. .
Tissue Specificity: Isoform CFL2b is expressed predominantly in skeletal muscle and heart. Isoform CFL2a is expressed in various tissues.
Gene ID: 1073
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Cofilin 2 (121-153aa KDAIKKKFTGIKHEWQVNGLDDIKDRSTLGEKL), identical to the related mouse sequence.
Calculated MW: 18737
Purification: Immunogen affinity purified.
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
| Is Featured? | No |
|---|
Write Your Own Review