Connexin 45/GJA7 Picoband polyclonal, anti-human, mouse, rat

Connexin 45/GJA7 Picoband polyclonal, anti-human, mouse, rat

€455.00
In stock
SKU
AC-ABO10340
Catalog Number: AC-ABO10340
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB, IHC-P
Datasheet
Request Information
Description: Rabbit IgG polyclonal antibody for Gap junction gamma-1 protein(GJC1) detection. Tested with WB, IHC-P in Human;Mouse;Rat.Protein Name: Gap junction gamma-1 protein

Protein Function:
One gap junction consists of a cluster of closely packed pairs of transmembrane channels, the connexons, through which materials of low MW diffuse from one cell to a neighboring cell.

Other Names: Gap junction gamma-1 protein, Connexin-45, Cx45, Gap junction alpha-7 protein, GJC1, GJA7

Subcellular Localization: Cell membrane; Multi-pass membrane protein. Cell junction, gap junction.

Gene ID: 10052

Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human Connexin 45/GJA7 (91-131aa YLGYAIHKIAKMEHGEADKKAARSKPYAMRWKQHRALEETE), identical to the related mouse and rat sequences.

Calculated MW: 45470

Purification: Immunogen affinity purified.

Format: Lyophilized

Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
More Information
Is Featured? No
Write Your Own Review
You're reviewing:Connexin 45/GJA7 Picoband polyclonal, anti-human, mouse, rat