Connexin 45/GJA7 polyclonal, anti-human, rat

Connexin 45/GJA7 polyclonal, anti-human, rat

€384.00
In stock
SKU
ARP-10-P9624
Catalog Number: 10-P9624
Isotype: rabbit polyclonal IgG

Information
Questions? Contact us!


Quantity: 100 µg

Background:
Gap junction gamma-1 protein (GJC1), also known as gap junction alpha-7 protein (GJA7) or connexin 45 (Cx45), is a protein that in humans is encoded by the GJC1 gene. The International Radiation Hybrid Mapping Consortium mapped the GJA7 gene to chromosome 17q21.31. This gene is a member of the connexin gene family. The encoded protein is a component of gap junctions, which are composed of arrays of intercellular channels that provide a route for the diffusion of low molecular weight materials from cell to cell.

Description:
Rabbit IgG polyclonal antibody for Gap junction gamma-1 protein (GJC1) detection. Tested with WB in Human, Rat.

Synonyms:
Connexin 45 antibody, Connexin-45 antibody, Connexin45 antibody, CX 31.9 antibody, CX 45 antibody, CX31.9 antibody, Cx45 antibody, CXG1_HUMAN antibody, DKFZp686P0738 antibody, Gap junction alpha 7 protein antibody, Gap junction alpha-7 protein antibody, Gap junction gamma 1 protein antibody, Gap junction gamma-1 protein antibody, Gap junction protein alpha 7 45kDa antibody, Gap junction protein alpha 7 antibody, Gap junction protein, gamma 1, 45kDa antibody, GJA 7 antibody, GJA7 antibody, GJC1 antibody, GJD3 antibody

Isotype: Rabbit polyclonal IgG

Immunogen:
A synthetic peptide corresponding to a sequence at the C-terminus of human Connexin 45/GJA7 (333-363aa ADLEALQREIRMAQERLDLAVQAYSHQNNP H), different from the related mouse and rat sequences by three amino acids.A synthetic peptide corresponding to a sequence at the C-terminus of human Connexin 45/GJA7 (333-363aa ADLEALQREIRMAQERLDLAVQAYSHQNNP H), different from the related mouse and rat sequences by three amino acids.

Form: Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Specificity:
No cross reactivity with other proteins.

Reactivity: Reacts with: human, rat

Applications: WB

Reconstitution:
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.
More Information
Is Featured? No
Write Your Own Review
You're reviewing:Connexin 45/GJA7 polyclonal, anti-human, rat