CPT1B Picoband polyclonal, anti-human, mouse, rat

CPT1B Picoband polyclonal, anti-human, mouse, rat

€455.00
In stock
SKU
AC-ABO12179
Catalog Number: AC-ABO12179
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB, IHC-P, IHC-F
Datasheet
Request Information
Description: Rabbit IgG polyclonal antibody for Carnitine O-palmitoyltransferase 1, muscle isoform (CPT1B) detection. Tested with WB, IHC-P, IHC-F in Human;Mouse;Rat.Protein Name: Carnitine O-palmitoyltransferase 1, muscle isoform

Other Names: Carnitine O-palmitoyltransferase 1, muscle isoform, CPT1-M, 2.3.1.21, Carnitine O-palmitoyltransferase I, muscle isoform, CPT I, CPTI-M, Carnitine palmitoyltransferase 1B, Carnitine palmitoyltransferase I-like protein, CPT1B, KIAA1670

Subcellular Localization: Mitochondrion outer membrane; Multi-pass membrane protein.

Tissue Specificity: Strong expression in heart and skeletal muscle. No expression in liver and kidney.

Gene ID: 1375

Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human CPT1B (197-226aa DDEEYYRMELLAKEFQDKTAPRLQKYLVLK), different from the related mouse sequence by two amino acids, and from the related rat sequence by four amino acids.

Calculated MW: 87801

Purification: Immunogen affinity purified.

Format: Lyophilized

Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
More Information
Is Featured? No
Write Your Own Review
You're reviewing:CPT1B Picoband polyclonal, anti-human, mouse, rat