CPT1B polyclonal, anti-human, mouse, rat

CPT1B polyclonal, anti-human, mouse, rat

€384.00
In stock
SKU
ARP-10-P9491
Catalog Number: 10-P9491
Isotype: rabbit polyclonal IgG

Information
Questions? Contact us!


Quantity: 100 µg

Background:
CPT1B is located on 22q13.33. The protein encoded by this gene, a member of the carnitine/ choline acetyltransferase family, is the rate-controlling enzyme of the long-chain fatty acid beta-oxidation pathway in muscle mitochondria. This enzyme is required for the net transport of long-chain fatty acyl-CoAs from the cytoplasm into the mitochondria. Multiple transcript variants encoding different isoforms have been found for this gene, and read-through transcripts are expressed from the upstream locus that include exons from this gene.

Description:
Rabbit IgG polyclonal antibody for Carnitine O-palmitoyltransferase 1, muscle isoform (CPT1B) detection. Tested with WB, IHC-P in Human, Mouse, Rat.

Synonyms:
muscle isoform antibody, Carnitine O palmitoyltransferase I mitochondrial muscle isoform antibody, Carnitine O palmitoyltransferase I muscle isoform antibody, Carnitine O-palmitoyl transferase 1, muscle isoform antibody, Carnitine O-palmitoyltransferase I antibody, Carnitine palmitoyltransferase 1A (muscle) antibody, Carnitine palmitoyltransferase 1B (muscle) antibody, Carnitine palmitoyltransferase 1B antibody, Carnitine palmitoyltransferase I like protein antibody, Carnitine palmitoyltransferase I muscle antibody, Carnitine palmitoyltransferase I-like protein antibody, CPT 1B antibody, CPT I antibody, CPT1 M antibody, CPT1 muscle antibody, CPT1-M antibody, Cpt1b antibody, CPT1B_HUMAN antibody, CPT1M antibody, CPTI antibody, CPTI M antibody, CPTI muscle antibody, CPTI-M antibody, CPTIM antibody, FLJ55729 antibody, FLJ58750 antibody, KIAA1670 antibody, M CPT1 antibody, M-CPT1 antibody, MCCPT1 antibody, MCPT1 antibody, muscle isoform antibody

Isotype: Rabbit polyclonal IgG

Immunogen:
A synthetic peptide corresponding to a sequence at the N-terminus of human CPT1B (197-226aa DDEEYYRMELLAKEFQDKTAPRLQKYLVLK), different from the related mouse sequence by two amino acids, and from the related rat sequence by four amino acids.

Form: Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Specificity:
No cross reactivity with other proteins.

Reactivity: Reacts with: human, mouse, rat

Applications: WB, IHC-P

Reconstitution:
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.
More Information
Is Featured? No
Write Your Own Review
You're reviewing:CPT1B polyclonal, anti-human, mouse, rat