CSNK1A1 polyclonal, anti-human, mouse, rat

CSNK1A1 polyclonal, anti-human, mouse, rat

€384.00
In stock
SKU
ARP-10-P9693
Catalog Number: 10-P9693
Isotype: rabbit polyclonal IgG

Information
Questions? Contact us!


Quantity: 100 µg

Background:
Casein kinase I isoform alpha is an enzyme that in humans is encoded by the CSNK1A1 gene. The CSNK1A1 gene is mapped to chromosome 5q32 based on an alignment of the CSNK1A1 sequence with the genomic sequence (GRCh37). It is reported that both screens identified CK1-alpha as a bifunctional regulator of NF-kappa-B. CK1-alpha dynamically associates with the CBM complex on T cell receptor engagement to participate in cytokine production and lymphocyte proliferation. However, CK1-alpha kinase activity has a contrasting role by subsequently promoting the phosphorylation and inactivation of CARMA1. CK1-alpha has thus a dual 'gating' function which first promotes and then terminates receptor-induced NF-kappa-B. ABC DLBCL cells required CK1-alpha for constitutive NF-kappa-B activity, indicating that CK1-alpha functions as a conditionally essential malignancy gene. 

Description:
Rabbit IgG polyclonal antibody for Casein kinase I isoform alpha (CSNK1A1) detection. Tested with WB, IHC-P in Human, Mouse, Rat.

Synonyms:
Casein kinase 1 alpha 1 antibody, Casein kinase I isoform alpha antibody, CK1 antibody, CK1A antibody, CKI alpha antibody, CKI-alpha antibody, CKIa antibody, Clock regulator kinase antibody, Csnk1a1 antibody, Down regulated in lung cancer antibody, HLCDGP1 antibody, KC1A_HUMAN antibody, PRO2975 antibody

Isotype: Rabbit polyclonal IgG

Immunogen:
A synthetic peptide corresponding to a sequence at the N-terminus of human CSNK1A1 (30-68aa DIYLAINITNGEEVAVKLESQKARHPQLLYESKLYKILQ), identical to the related mouse and rat sequences.

Form: Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Specificity:
No cross reactivity with other proteins.

Reactivity: Reacts with: human, mouse, rat

Applications: WB, IHC-P

Reconstitution:
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.
More Information
Is Featured? No
Write Your Own Review
You're reviewing:CSNK1A1 polyclonal, anti-human, mouse, rat