Cyclin T1 Picoband polyclonal, anti-human, mouse, rat

Cyclin T1 Picoband polyclonal, anti-human, mouse, rat

€455.00
In stock
SKU
AC-ABO12675
Catalog Number: AC-ABO12675
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB, IHC-P
Datasheet
Request Information
Description: Rabbit IgG polyclonal antibody for Cyclin-T1(CCNT1) detection. Tested with WB, IHC-P in Human;Mouse;Rat.Protein Name: Cyclin-T1

Protein Function:
Regulatory subunit of the cyclin-dependent kinase pair (CDK9/cyclin-T1) complex, also called positive transcription elongation factor B (P-TEFb), which is proposed to facilitate the transition from abortive to productive elongation by phosphorylating the CTD (carboxy-terminal domain) of the large subunit of RNA polymerase II (RNA Pol II). .

Other Names: Cyclin-T1, CycT1, Cyclin-T, CCNT1

Subcellular Localization: Nucleus .

Tissue Specificity: Ubiquitously expressed.

Gene ID: 904

Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human Cyclin T1 (375-410aa QKQNSKSVPSAKVSLKEYRAKHAEELAAQKRQLENM), different from the related mouse sequence by one amino acid.

Calculated MW: 80685

Purification: Immunogen affinity purified.

Format: Lyophilized

Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
More Information
Is Featured? No
Write Your Own Review
You're reviewing:Cyclin T1 Picoband polyclonal, anti-human, mouse, rat