CYP27B1 polyclonal, anti-human, mouse, rat

Quantity: 100 µg

Background:
CYP27B1 belongs to the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. The protein encoded by this gene localizes to the inner mitochondrial membrane where it hydroxylates 25-hydroxyvitamin D3 at the 1alpha position. This reaction synthesizes 1alpha,25-dihydroxyvitamin D3, the active form of vitamin D3, which binds to the vitamin D receptor and regulates calcium metabolism. Thus this enzyme regulates the level of biologically active vitamin D and plays an important role in calcium homeostasis. Mutations in this gene can result in vitamin D-dependent rickets type I.

Description:
Rabbit IgG polyclonal antibody for 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial (CYP27B1) detection. Tested with WB, IHC-P in Human, Mouse, Rat.

Synonyms:
1alpha(OH)ase antibody, 25-hydroxyvitamin D(3) 1-alpha-hydroxylase antibody, 25-hydroxyvitamin D-1 alpha hydroxylase antibody, 25-OHD-1 alpha-hydroxylase antibody, Calcidiol 1-monooxygenase antibody, CP27B_HUMAN antibody, CP2B antibody, CYP1 antibody, CYP1ALPHA antibody, CYP27B antibody, Cyp27b1 antibody, Cytochrome p450 27B1 antibody, Cytochrome p450 27B13 antibody, Cytochrome P450 family 27 subfamily B polypeptide 1 antibody, Cytochrome P450 subfamily XXVIIB (25-hydroxyvitamin D-1-alpha-hydroxylase) polypeptide 1 antibody, Cytochrome P450 subfamily XXVIIB polypeptide 1 antibody, Cytochrome P450C1 alpha antibody, Cytochrome P450VD1-alpha antibody, mitochondrial antibody, P450C1 alpha antibody, P450c1 antibody, P450C1-alpha antibody, P450VD1-alpha antibody, PDDR antibody, VD3 1A hydroxylase antibody, VDD1 antibody, VDDR antibody, VDDR I antibody, VDDRI antibody, VDR antibody

Isotype: Rabbit polyclonal IgG

Immunogen:
A synthetic peptide corresponding to a sequence at the C-terminus of human CYP27B1 (475-508aa HFEVQPEPGAAPVRPKTRTVLVPERSINLQFLDR), different from the related mouse and rat sequences by six amino acids.

Form: Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Specificity:
No cross reactivity with other proteins.

Reactivity: Reacts with: human, mouse, rat

Applications: WB, IHC-P

Reconstitution:
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.