CYP3A4 Picoband polyclonal, anti-human

CYP3A4 Picoband polyclonal, anti-human

€455.00
In stock
SKU
AC-ABO11673
Catalog Number: AC-ABO11673
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB, IHC-P
Datasheet
Request Information
Description: Rabbit IgG polyclonal antibody for Cytochrome P450 3A4(CYP3A4) detection. Tested with WB, IHC-P in Human.Protein Name: Cytochrome P450 3A4

Protein Function:
Cytochromes P450 are a group of heme-thiolate monooxygenases. In liver microsomes, this enzyme is involved in an NADPH-dependent electron transport pathway. It performs a variety of oxidation reactions (e.g. caffeine 8-oxidation, omeprazole sulphoxidation, midazolam 1'-hydroxylation and midazolam 4- hydroxylation) of structurally unrelated compounds, including steroids, fatty acids, and xenobiotics. Acts as a 1,8-cineole 2- exo-monooxygenase. The enzyme also hydroxylates etoposide (PubMed:11159812). Catalyzes 4-beta-hydroxylation of cholesterol. May catalyze 25-hydroxylation of cholesterol in vitro (PubMed:21576599). .

Other Names: Cytochrome P450 3A4, 1.14.13.-, 1,8-cineole 2-exo-monooxygenase, 1.14.13.157, Albendazole monooxygenase, 1.14.13.32, Albendazole sulfoxidase, CYPIIIA3, CYPIIIA4, Cholesterol 25-hydroxylase, 1.14.14.1, Cytochrome P450 3A3, Cytochrome P450 HLp, Cytochrome P450 NF-25, Cytochrome P450-PCN1, Nifedipine oxidase, Quinine 3-monooxygenase, 1.14.13.67, Taurochenodeoxycholate 6-alpha-hydroxylase, 1.14.13.97, CYP3A4, CYP3A3

Subcellular Localization: Endoplasmic reticulum membrane; Single-pass membrane protein. Microsome membrane ; Single-pass membrane protein.

Tissue Specificity: Expressed in prostate and liver. According to some authors, it is not expressed in brain (PubMed:19094056). According to others, weak levels of expression are measured in some brain locations (PubMed:19359404 and PubMed:18545703). Also expressed in epithelium of the small intestine and large intestine, bile duct, nasal mucosa, kidney, adrenal cortex, epithelium of the gastric mucosa with intestinal metaplasia, gallbladder, intercalated ducts of the pancreas, chief cells of the parathyroid and the corpus luteum of the ovary (at protein level). .

Gene ID: 1576

Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human CYP3A4 (237-277aa NICVFPREVTNFLRKSVKRMKESRLEDTQKHRVDFLQLMID).

Calculated MW: 57343

Purification: Immunogen affinity purified.

Format: Lyophilized

Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
More Information
Is Featured? No
Write Your Own Review
You're reviewing:CYP3A4 Picoband polyclonal, anti-human