Cytokeratin 1 polyclonal, anti-human, mouse, rat

Quantity: 100 µg

Background:
Keratin 1 (KRT1), also known as Cytokeratin 1, or Keratin, type II cytoskeletal 1, is a member of the keratin family. It is specifically expressed in the spinous and granular layers of the epidermis with family member keratin 10. Mutations in this gene have been associated with the variants ofbullous congenital ichthyosiform erythroderma in which the palms and soles of the feet are affected. The type II cytokeratins consist of basic or neutral proteins which are arranged in pairs of heterotypic keratin chains coexpressed during differentiation of simple and stratified epithelial tissues. And this type II cytokeratin is specifically expressed in the spinous and granular layers of the epidermis with family member KRT10 and mutations in these genes have been associated with bullous congenital ichthyosiform erythroderma. The type II cytokeratins are clustered in a region of chromosome 12q12-q13.

Description:
Rabbit IgG polyclonal antibody for Keratin, type II cytoskeletal 1 (KRT1) detection. Tested with WB, IHC-P in Human, Mouse, Rat.

Synonyms:
67 kDa cytokeratin antibody, CK-1 antibody, CK1 antibody, Cytokeratin-1 antibody, Cytokeratin1 antibody, EHK antibody, EHK1 antibody, Epidermolytic hyperkeratosis 1 antibody, EPPK antibody, Hair alpha protein antibody, K1 antibody, K2C1_HUMAN antibody, Keratin antibody, Keratin type II cytoskeletal 1 antibody, Keratin-1 antibody, Keratin1 antibody, KRT 1 antibody, Krt1 antibody, KRT1A antibody, NEPPK antibody, type II cytoskeletal 1 antibody, Type II keratin Kb1 antibody, Type-II keratin Kb1 antibody

Isotype: Rabbit polyclonal IgG

Immunogen:
A synthetic peptide corresponding to a sequence at the N-terminus of mouse Cytokeratin 1 (223-257aa LQQVDTTTRTQNLDPFFENYISILRRKVDSLKSD Q), different from the related human sequence by ten amino acids, and from the related rat sequence by five amino acids.

Form: Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Specificity:
No cross reactivity with other proteins.

Reactivity: Reacts with: human, mouse, rat

Applications: WB, IHC-P

Reconstitution:
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.