Cytokeratin 19 polyclonal, anti-human, mouse, rat

Quantity: 100 µg

Background:
Keratin, type I cytoskeletal 19 is a protein that in humans is encoded by the KRT19 gene. The protein encoded by this gene is a member of the keratin family. It is specifically expressed in the periderm, the transiently superficial layer that envelops the developing epidermis. The type I cytokeratins are clustered in a region of chromosome 17q12-q21. Due to its high sensitivity, KRT19 is the most used marker for the RT-PCR-mediated detection of tumor cells disseminated in lymph nodes, peripheral blood, and bone marrow of breast cancer patients. Keratin 19 is often used together with keratin 8 and keratin 18 to differentiate cells of epithelial origin from hematopoietic cells in tests that enumerate circulating tumor cells in blood.

Description:
Rabbit IgG polyclonal antibody for Keratin, type I cytoskeletal 19 (KRT19) detection. Tested with WB, IHC-P in Human, Mouse, Rat.

Synonyms:
40 kDa keratin intermediate filament antibody, CK 19 antibody, CK-19 antibody, ck19 antibody, Cytokeratin 19 antibody, Cytokeratin-19 antibody, k19 antibody, K1C19_HUMAN antibody, k1cs antibody, Keratin 19 antibody, Keratin type I 40 kD antibody, Keratin type i 40kD antibody, Keratin type I cytoskeletal 19 antibody, Keratin, type I cytoskeletal 19 antibody, Keratin, type I, 40 kd antibody, Keratin-19 antibody, krt19 antibody, mgc15366 antibody

Isotype: Rabbit polyclonal IgG

Immunogen:
A synthetic peptide corresponding to a sequence at the C-terminus of human Cytokeratin 19 (334-372aa QLAHIQALISGIEAQLGDVRADSERQNQEYQRLMDIKSR), different from the related mouse and rat sequences by nine amino acids.

Form: Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Specificity:
No cross reactivity with other proteins.

Reactivity: Reacts with: human, mouse, rat

Applications: WB, IHC-P

Reconstitution:
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.