Cytokeratin 5 Picoband polyclonal, anti-human, mouse, rat
€455.00
In stock
SKU
AC-ABO10071
Catalog Number: AC-ABO10071
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB, IHC-P
Datasheet
Request Information
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB, IHC-P
Datasheet
Request Information
Description: Rabbit IgG polyclonal antibody for Keratin, type II cytoskeletal 5(KRT5) detection. Tested with WB, IHC-P in Human;Mouse;Rat.Protein Name: Keratin, type II cytoskeletal 5
Other Names: Keratin, type II cytoskeletal 5, 58 kDa cytokeratin, Cytokeratin-5, CK-5, Keratin-5, K5, Type-II keratin Kb5, KRT5
Gene ID: 3852
Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human Cytokeratin 5 (286-317aa KVELEAKVDALMDEINFMKMFFDAELSQMQTH), different from the related mouse sequence by one amino acid, and identical to the related rat sequence.
Calculated MW: 62378
Purification: Immunogen affinity purified.
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
Other Names: Keratin, type II cytoskeletal 5, 58 kDa cytokeratin, Cytokeratin-5, CK-5, Keratin-5, K5, Type-II keratin Kb5, KRT5
Gene ID: 3852
Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human Cytokeratin 5 (286-317aa KVELEAKVDALMDEINFMKMFFDAELSQMQTH), different from the related mouse sequence by one amino acid, and identical to the related rat sequence.
Calculated MW: 62378
Purification: Immunogen affinity purified.
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
| Is Featured? | No |
|---|
Write Your Own Review