DARPP32 Picoband polyclonal, anti-human, mouse, rat
€455.00
In stock
SKU
AC-ABO12565
Catalog Number: AC-ABO12565
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB, IHC-P
Datasheet
Request Information
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB, IHC-P
Datasheet
Request Information
Description: Rabbit IgG polyclonal antibody for Protein phosphatase 1 regulatory subunit 1B(PPP1R1B) detection. Tested with WB, IHC-P in Human;Mouse;Rat.Protein Name: Protein phosphatase 1 regulatory subunit 1B
Protein Function:
Inhibitor of protein-phosphatase 1.
Other Names: Protein phosphatase 1 regulatory subunit 1B, DARPP-32, Dopamine- and cAMP-regulated neuronal phosphoprotein, PPP1R1B, DARPP32
Subcellular Localization: Cytoplasm.
Gene ID: 84152
Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human DARPP32 (1-36aa MDPKDRKKIQFSVPAPPSQLDPRQVEMIRRRRPTPA), identical to the related mouse and rat sequences.
Calculated MW: 22963
Purification: Immunogen affinity purified.
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
Protein Function:
Inhibitor of protein-phosphatase 1.
Other Names: Protein phosphatase 1 regulatory subunit 1B, DARPP-32, Dopamine- and cAMP-regulated neuronal phosphoprotein, PPP1R1B, DARPP32
Subcellular Localization: Cytoplasm.
Gene ID: 84152
Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human DARPP32 (1-36aa MDPKDRKKIQFSVPAPPSQLDPRQVEMIRRRRPTPA), identical to the related mouse and rat sequences.
Calculated MW: 22963
Purification: Immunogen affinity purified.
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
| Is Featured? | No |
|---|
Write Your Own Review