DARPP32 polyclonal, anti-human, mouse, rat

Quantity: 100 µg

Background:
Protein phosphatase 1 regulatory subunit 1B (PPP1R1B), also known as dopamine- and cAMP-regulated neuronal phosphoprotein (DARPP-32), is a protein that in humans is encoded by the PPP1R1B gene. This gene encodes a bifunctional signal transduction molecule. Dopaminergic and glutamatergic receptor stimulation regulates its phosphorylation and function as a kinase or phosphatase inhibitor. As a target for dopamine, this gene may serve as a therapeutic target for neurologic and psychiatric disorders. Multiple transcript variants encoding different isoforms have been found for this gene.

Description:
Rabbit IgG polyclonal antibody for Protein phosphatase 1 regulatory subunit 1B (PPP1R1B) detection. Tested with WB, IHC-P in Human, Mouse, Rat.

Synonyms:
DARPP 32 antibody, DARPP-32 antibody, Dopamine and cAMP regulated neuronal phosphoprotein 32 antibody, Dopamine and cAMP regulated neuronal phosphoprotein antibody, Dopamine and cAMP regulated phosphoprotein antibody, Dopamine and cAMP regulated phosphoprotein DARPP 32 antibody, Dopamine and cAMP regulated phosphoprotein DARPP32 antibody, Dopamine- and cAMP-regulated neuronal phosphoprotein antibody, FLJ20940 antibody, IPPD antibody, Neuronal phosphoprotein DARPP 32 antibody, PPP1R1B antibody, PPR1B_HUMAN antibody, Protein phosphatase 1 regulatory (inhibitor) subunit 1B antibody, Protein phosphatase 1 regulatory subunit 1B antibody

Isotype: Rabbit polyclonal IgG

Immunogen:
A synthetic peptide corresponding to a sequence at the N-terminus of human DARPP32 (1-36aa MDPKDRKKIQFSVPAPPSQLDPRQVEMIRRRRPTPA), identical to the related mouse and rat sequences.

Form: Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Specificity:
No cross reactivity with other proteins.

Reactivity: Reacts with: human, mouse, rat

Applications: WB, IHC-P

Reconstitution:
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.