DDAH1 Picoband polyclonal, anti-human, mouse, rat

DDAH1 Picoband polyclonal, anti-human, mouse, rat

€455.00
In stock
SKU
AC-ABO11618
Catalog Number: AC-ABO11618
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB
Datasheet
Request Information
Description: Rabbit IgG polyclonal antibody for N(G),N(G)-dimethylarginine dimethylaminohydrolase 1(DDAH1) detection. Tested with WB in Human;Mouse;Rat.Protein Name: N(G),N(G)-dimethylarginine dimethylaminohydrolase 1

Protein Function:
Hydrolyzes N(G),N(G)-dimethyl-L-arginine (ADMA) and N(G)-monomethyl-L-arginine (MMA) which act as inhibitors of NOS. Has therefore a role in the regulation of nitric oxide generation.

Other Names: N(G),N(G)-dimethylarginine dimethylaminohydrolase 1, DDAH-1, Dimethylarginine dimethylaminohydrolase 1, 3.5.3.18, DDAHI, Dimethylargininase-1, DDAH1, DDAH

Tissue Specificity: Detected in brain, liver, kidney and pancreas, and at low levels in skeletal muscle. .

Gene ID: 23576

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human DDAH1 (195-226aa QKALKIMQQMSDHRYDKLTVPDDIAANCIYLN), different from the related mouse and rat sequences by one amino acid.

Calculated MW: 31122

Purification: Immunogen affinity purified.

Format: Lyophilized

Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
More Information
Is Featured? No
Write Your Own Review
You're reviewing:DDAH1 Picoband polyclonal, anti-human, mouse, rat