DDAH2 Picoband polyclonal, anti-human, mouse, rat
€455.00
In stock
SKU
AC-ABO11619
Catalog Number: AC-ABO11619
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB, IHC-P
Datasheet
Request Information
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB, IHC-P
Datasheet
Request Information
Description: Rabbit IgG polyclonal antibody for N(G),N(G)-dimethylarginine dimethylaminohydrolase 2(DDAH2) detection. Tested with WB, IHC-P in Human;Mouse;Rat.Protein Name: N(G),N(G)-dimethylarginine dimethylaminohydrolase 2
Protein Function:
Hydrolyzes N(G),N(G)-dimethyl-L-arginine (ADMA) and N(G)-monomethyl-L-arginine (MMA) which act as inhibitors of NOS. Has therefore a role in the regulation of nitric oxide generation. .
Other Names: N(G),N(G)-dimethylarginine dimethylaminohydrolase 2, DDAH-2, Dimethylarginine dimethylaminohydrolase 2, 3.5.3.18, DDAHII, Dimethylargininase-2, Protein G6a, S-phase protein, DDAH2, DDAH, G6A, NG30
Subcellular Localization: Cytoplasm . Mitochondrion . Translocates from cytosol to mitochondrion upon IL-1beta stimulation in chondrocytes.
Tissue Specificity: Detected in heart, placenta, lung, liver, skeletal muscle, kidney and pancreas, and at very low levels in brain. .
Gene ID: 23564
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human DDAH2 (190-224aa DAAQKAVRAMAVLTDHPYASLTLPDDAAADCLFLR), different from the related mouse and rat sequences by three amino acids.
Calculated MW: 29644
Purification: Immunogen affinity purified.
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
Protein Function:
Hydrolyzes N(G),N(G)-dimethyl-L-arginine (ADMA) and N(G)-monomethyl-L-arginine (MMA) which act as inhibitors of NOS. Has therefore a role in the regulation of nitric oxide generation. .
Other Names: N(G),N(G)-dimethylarginine dimethylaminohydrolase 2, DDAH-2, Dimethylarginine dimethylaminohydrolase 2, 3.5.3.18, DDAHII, Dimethylargininase-2, Protein G6a, S-phase protein, DDAH2, DDAH, G6A, NG30
Subcellular Localization: Cytoplasm . Mitochondrion . Translocates from cytosol to mitochondrion upon IL-1beta stimulation in chondrocytes.
Tissue Specificity: Detected in heart, placenta, lung, liver, skeletal muscle, kidney and pancreas, and at very low levels in brain. .
Gene ID: 23564
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human DDAH2 (190-224aa DAAQKAVRAMAVLTDHPYASLTLPDDAAADCLFLR), different from the related mouse and rat sequences by three amino acids.
Calculated MW: 29644
Purification: Immunogen affinity purified.
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
| Is Featured? | No |
|---|
Write Your Own Review