DGAT1 Picoband polyclonal, anti-human, rat

DGAT1 Picoband polyclonal, anti-human, rat

€455.00
In stock
SKU
AC-ABO12487
Catalog Number: AC-ABO12487
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB
Datasheet
Request Information
Description: Rabbit IgG polyclonal antibody for Diacylglycerol O-acyltransferase 1(DGAT1) detection. Tested with WB in Human;Rat.Protein Name: Diacylglycerol O-acyltransferase 1

Protein Function:
Catalyzes the terminal and only committed step in triacylglycerol synthesis by using diacylglycerol and fatty acyl CoA as substrates. In contrast to DGAT2 it is not essential for survival. May be involved in VLDL (very low density lipoprotein) assembly. In liver, plays a role in esterifying exogenous fatty acids to glycerol. Functions as the major acyl-CoA retinol acyltransferase (ARAT) in the skin, where it acts to maintain retinoid homeostasis and prevent retinoid toxicity leading to skin and hair disorders. .

Other Names: Diacylglycerol O-acyltransferase 1, 2.3.1.20, ACAT-related gene product 1, Acyl-CoA retinol O-fatty-acyltransferase, ARAT, Retinol O-fatty-acyltransferase, 2.3.1.76, Diglyceride acyltransferase, DGAT1, AGRP1, DGAT

Subcellular Localization: Endoplasmic reticulum membrane ; Multi-pass membrane protein .

Gene ID: 8694

Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human DGAT1 (280-318aa RRILEMLFFTQLQVGLIQQWMVPTIQNSMKPFKDMDYSR), different from the related mouse and rat sequences by one amino acid.

Calculated MW: 55278

Purification: Immunogen affinity purified.

Format: Lyophilized

Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
More Information
Is Featured? No
Write Your Own Review
You're reviewing:DGAT1 Picoband polyclonal, anti-human, rat