DGAT1 polyclonal, anti-human, rat

Quantity: 100 µg

Background:
Acyl-CoA: diacylglycerol acyltransferase (DGAT) is a microsomal enzyme that plays a central role in the metabolism of cellular diacylglycerol lipids and catalyzes the terminal and only committed step in triacylglycerol synthesis by using diacylglycerol (DAG) and fatty acyl CoA as substrates. DGAT had been considered necessary for adipose tissue formation and essential for survival. There are two isozymes of DGAT encoded by the genes DGAT1 and DGAT2. DGAT1 is a host factor for HCV infection that binds core protein, localizes it to DGAT1-generated lipid droplets, and recruits viral RNA replication complexes for viral assembly. DGAT2-generated lipid droplets formed normally in cells treated with the DGAT1 inhibitor, suggesting that DGAT1 inhibitors may be useful as antiviral therapeutics.

Description:
Rabbit IgG polyclonal antibody for Diacylglycerol O-acyltransferase 1 (DGAT1) detection. Tested with WB in Human, Rat.

Synonyms:
ACAT related gene product 1 antibody, ACAT-related gene product 1 antibody, Acyl coenzyme A:cholesterol acyltransferase related gene 1 antibody, Acyl-CoA retinol O-fatty-acyltransferase antibody, Acyl-CoA:diacylglycerol acyltransferase antibody, ARAT antibody, ARGP1 antibody, C75990 antibody, D15Ertd23e antibody, Dgat antibody, DGAT1 antibody, DGAT1_HUMAN antibody, Diacylglycerol O acyltransferase 1 antibody, Diacylglycerol O-acyltransferase 1 antibody, DIAR7 antibody, Diglyceride acyltransferase antibody, EC 2.3.1.20 antibody, hCG_24006 antibody, MGC139064 antibody, Retinol O fatty acyltransferase antibody

Isotype: Rabbit polyclonal IgG

Immunogen:
A synthetic peptide corresponding to a sequence in the middle region of human DGAT1 (280-318aa RRILEMLFFTQLQVGLIQQWMVPTIQNSMKPFKDMDYSR), different from the related mouse and rat sequences by one amino acid.A synthetic peptide corresponding to a sequence in the middle region of human DGAT1 (280-318aa RRILEMLFFTQLQVGLIQQWMVPTIQNSMKPFKDMDYSR), different from the related mouse and rat sequences by one amino acid.

Form: Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Specificity:
No cross reactivity with other proteins.

Reactivity: Reacts with: human, rat

Applications: WB

Reconstitution:
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.