DHODH Picoband polyclonal, anti-human, mouse, rat

DHODH Picoband polyclonal, anti-human, mouse, rat

€455.00
In stock
SKU
AC-ABO11674
Catalog Number: AC-ABO11674
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB, IHC-P
Datasheet
Request Information
Description: Rabbit IgG polyclonal antibody for Dihydroorotate dehydrogenase (quinone), mitochondrial(DHODH) detection. Tested with WB, IHC-P in Human;Mouse;Rat.Protein Name: Dihydroorotate dehydrogenase (quinone), mitochondrial

Protein Function:
Catalyzes the conversion of dihydroorotate to orotate with quinone as electron acceptor.

Other Names: Dihydroorotate dehydrogenase (quinone), mitochondrial, DHOdehase, 1.3.5.2, Dihydroorotate oxidase, DHODH

Subcellular Localization: Mitochondrion inner membrane ; Single-pass membrane protein .

Gene ID: 1723

Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human DHODH (132-173aa RVFRLPEDQAVINRYGFNSHGLSVVEHRLRARQQKQAKLTE D), different from the related mouse sequence by four amino acids, and from the related rat sequence by two amino acids.

Calculated MW: 42867

Purification: Immunogen affinity purified.

Format: Lyophilized

Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
More Information
Is Featured? No
Write Your Own Review
You're reviewing:DHODH Picoband polyclonal, anti-human, mouse, rat