Dishevelled 3 Picoband polyclonal, anti-human, mouse, rat
€455.00
In stock
SKU
AC-ABO10292
Catalog Number: AC-ABO10292
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB
Datasheet
Request Information
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB
Datasheet
Request Information
Description: Rabbit IgG polyclonal antibody for Segment polarity protein dishevelled homolog DVL-3(DVL3) detection. Tested with WB in Human;Mouse;Rat.Protein Name: Segment polarity protein dishevelled homolog DVL-3
Protein Function:
May play a role in the signal transduction pathway mediated by multiple Wnt genes.
Other Names: Segment polarity protein dishevelled homolog DVL-3, Dishevelled-3, DSH homolog 3, DVL3, KIAA0208
Subcellular Localization: Cytoplasm .
Gene ID: 1857
Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human Dishevelled 3 (397-434aa DTERLDDFHLSIHSDMAAIVKAMASPESGLEVRDRMW L), identical to the related mouse sequence.
Calculated MW: 78055
Purification: Immunogen affinity purified.
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
Protein Function:
May play a role in the signal transduction pathway mediated by multiple Wnt genes.
Other Names: Segment polarity protein dishevelled homolog DVL-3, Dishevelled-3, DSH homolog 3, DVL3, KIAA0208
Subcellular Localization: Cytoplasm .
Gene ID: 1857
Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human Dishevelled 3 (397-434aa DTERLDDFHLSIHSDMAAIVKAMASPESGLEVRDRMW L), identical to the related mouse sequence.
Calculated MW: 78055
Purification: Immunogen affinity purified.
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
| Is Featured? | No |
|---|
Write Your Own Review