Dishevelled 3 Picoband polyclonal, anti-human, mouse, rat

Dishevelled 3 Picoband polyclonal, anti-human, mouse, rat

€455.00
In stock
SKU
AC-ABO10292
Catalog Number: AC-ABO10292
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB
Datasheet
Request Information
Description: Rabbit IgG polyclonal antibody for Segment polarity protein dishevelled homolog DVL-3(DVL3) detection. Tested with WB in Human;Mouse;Rat.Protein Name: Segment polarity protein dishevelled homolog DVL-3

Protein Function:
May play a role in the signal transduction pathway mediated by multiple Wnt genes.

Other Names: Segment polarity protein dishevelled homolog DVL-3, Dishevelled-3, DSH homolog 3, DVL3, KIAA0208

Subcellular Localization: Cytoplasm .

Gene ID: 1857

Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human Dishevelled 3 (397-434aa DTERLDDFHLSIHSDMAAIVKAMASPESGLEVRDRMW L), identical to the related mouse sequence.

Calculated MW: 78055

Purification: Immunogen affinity purified.

Format: Lyophilized

Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
More Information
Is Featured? No
Write Your Own Review
You're reviewing:Dishevelled 3 Picoband polyclonal, anti-human, mouse, rat