E-Cadherin polyclonal, anti-human antibody
€270.00
In stock
SKU
AC-ABO11384
Description: Rabbit IgG polyclonal antibody for Involucrin (IVL) detection. Tested with WB in human.
Protein Name: Involucrin
Background:
Part of the insoluble cornified cell envelope (CE) of stratified squamous epithelia.
Other Names:
Involucrin, IVL
Subcellular Localization: Cytoplasm. Constituent of the scaffolding of the cornified envelope.
Tissue Specificity: Keratinocytes of epidermis and other stratified squamous epithelia.
Gene ID: 3713
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Involucrin (551-585aa QVQDIQPALPTKGEVLLPVEHQQQKQEVQWPPKHK).
Calculated MW: 68479
Purification: Immunogen affinity purified.
Format: Lyophilized
Contents: Each vial contains 5mg BSA, 0.9 mg NaCl, 0.2mg Na2HPO4, 0.05 mg NaN3.
Concentration (mg/ml): Add 0.2 ml of distilled water will yield a concentration of 500 µg/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.
Protein Name: Involucrin
Background:
Part of the insoluble cornified cell envelope (CE) of stratified squamous epithelia.
Other Names:
Involucrin, IVL
Subcellular Localization: Cytoplasm. Constituent of the scaffolding of the cornified envelope.
Tissue Specificity: Keratinocytes of epidermis and other stratified squamous epithelia.
Gene ID: 3713
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Involucrin (551-585aa QVQDIQPALPTKGEVLLPVEHQQQKQEVQWPPKHK).
Calculated MW: 68479
Purification: Immunogen affinity purified.
Format: Lyophilized
Contents: Each vial contains 5mg BSA, 0.9 mg NaCl, 0.2mg Na2HPO4, 0.05 mg NaN3.
Concentration (mg/ml): Add 0.2 ml of distilled water will yield a concentration of 500 µg/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.
| Is Featured? | No |
|---|
Write Your Own Review