ELAVL4 polyclonal, anti-human, mouse, rat

Quantity: 100 µg

Background:
HuD otherwise known as ELAV-like protein 4 or PNEM is a protein that in humans is encoded by the ELAVL4 gene. This human gene is located at 1p34 by in situ hybridization. The HuD/ELAVL4 protein is an RNA-binding protein. ELAVL4 has specificity for 3-prime uridylate-rich untranslated regions of growth factor mRNAs. And HuD is expressed only in neurons and it binds to AU-rich element-containing mRNAs. As a result of this interaction the, half-life of the transcript is increased. Also, HuD is important in neurons during brain development and plasticity.

Description:
Rabbit IgG polyclonal antibody for ELAV-like protein 4 (ELAVL4) detection. Tested with WB, IHC-P in Human, Mouse, Rat.

Synonyms:
ELAV (embryonic lethal abnormal vision Drosophila) like 4 antibody, ELAV L4 antibody, ELAV like 4 antibody, ELAV like protein 4 antibody, ELAV-like protein 4 antibody, ELAV4_HUMAN antibody, Elavl4 antibody, Embryonic lethal abnormal vision Drosophila homolog of like 4 antibody, Hu antigen D antibody, Hu-antigen D antibody, HuD antibody, Paraneoplastic encephalomyelitis antigen HuD antibody, PNEM antibody

Isotype: Rabbit polyclonal IgG

Immunogen:
A synthetic peptide corresponding to a sequence at the N-terminus of human ELAVL4 (8-45aa MEPQVSNGPTSNTSNGPSSNNRNCPSPMQTGATTDDSK), different from the related mouse and rat sequences by one amino acid.

Form: Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Specificity:
No cross reactivity with other proteins.

Reactivity: Reacts with: human, mouse, rat

Applications: WB, IHC-P

Reconstitution:
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.