EME1 Picoband polyclonal, anti-human, rat

EME1 Picoband polyclonal, anti-human, rat

€455.00
In stock
SKU
AC-ABO12490
Catalog Number: AC-ABO12490
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB, IHC-P
Datasheet
Request Information
Description: Rabbit IgG polyclonal antibody for Crossover junction endonuclease EME1(EME1) detection. Tested with WB, IHC-P in Human;Rat.Protein Name: Crossover junction endonuclease EME1

Protein Function:
Interacts with MUS81 to form a DNA structure-specific endonuclease with substrate preference for branched DNA structures with a 5'-end at the branch nick. Typical substrates include 3'- flap structures, replication forks and nicked Holliday junctions. May be required in mitosis for the processing of stalled or collapsed replication forks. .

Other Names: Crossover junction endonuclease EME1, 3.1.22.-, MMS4 homolog, hMMS4, EME1, MMS4

Subcellular Localization: Nucleus, nucleolus . Recruited to regions of DNA damage in S-phase cells.

Gene ID: 146956

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human EME1 (520-561aa DKERQNLLADIQVRRGEGVTSTSRRIGPELSRRIYLQMTTLQ ), different from the related mouse sequence by five amino acids.

Calculated MW: 63252

Purification: Immunogen affinity purified.

Format: Lyophilized

Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
More Information
Is Featured? No
Write Your Own Review
You're reviewing:EME1 Picoband polyclonal, anti-human, rat