EME1 polyclonal, anti-human, rat
€384.00
In stock
SKU
ARP-10-P9804
Quantity: 100 µg
Background:
Crossover junction endonuclease EME1 is an enzyme that in humans is encoded by the EME1 gene. It is mapped to 17q21.33. This gene encodes a protein that complexes with methyl methanesulfonate-sensitive UV-sensitive 81 protein to form an endonuclease complex. The encoded protein interacts with specifc DNA structures including nicked Holliday junctions, 3'-flap structures and aberrant replication fork structures. Also, this protein may be involved in repairing DNA damage and in maintaining genomic stability. Alternative splicing results in multiple transcript variants.
Description:
Rabbit IgG polyclonal antibody for Crossover junction endonuclease EME1 (EME1) detection. Tested with WB, IHC-P in Human, Rat.
Synonyms:
6820428D13 antibody, Crossover junction endonuclease EME1 antibody, EC 3.1.22.- antibody, EME1 antibody, Eme1 essential meiotic endonuclease 1 homolog 1 (S. pombe) antibody, EME1, S. pombe, homolog of, 1 antibody, EME1_HUMAN antibody, essential meiotic endonuclease 1 homolog 1 (S pombe) antibody, Essential Meiotic Endonuclease 1 Homolog 1 antibody, essential meiotic endonuclease 1 homolog 2 antibody, Essential meiotic endonuclease 1, S. pombe, homolog of, 1 antibody, FLJ31364 antibody, hMMS4 antibody, homolog of yeast EME1 endonuclease antibody, MGC106543 antibody, MMS4 antibody, MMS4 homolog antibody, MMS4L antibody
Isotype: Rabbit polyclonal IgG
Immunogen:
A synthetic peptide corresponding to a sequence at the C-terminus of human EME1 (520-561aa DKERQNLLADIQVRRGEGVTSTSRRIGPELSRRIYLQMTTLQ ), different from the related mouse sequence by five amino acids.A synthetic peptide corresponding to a sequence at the C-terminus of human EME1 (520-561aa DKERQNLLADIQVRRGEGVTSTSRRIGPELSRRIYLQMTTLQ ), different from the related mouse sequence by five amino acids.
Form: Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Specificity:
No cross reactivity with other proteins.
Reactivity: Reacts with: human, rat
Applications: WB, IHC-P
Reconstitution:
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.
| Is Featured? | No |
|---|
Write Your Own Review