Eph receptor B1 polyclonal, anti-human

Quantity: 100 µg

Background:
Ephrin type-B receptor 1 is a protein that in humans is encoded by the EPHB1 gene. Ephrin receptors and their ligands, the ephrins, mediate numerous developmental processes, particularly in the nervous system. Based on their structures and sequence relationships, ephrins are divided into the ephrin-A (EFNA) class, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB) class, which are transmembrane proteins. The Eph family of receptors are divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands. Ephrin receptors make up the largest subgroup of the receptor tyrosine kinase (RTK) family. The protein encoded by this gene is a receptor for ephrin-B family members.

Description:
Rabbit IgG polyclonal antibody for Ephrin type-B receptor 1 (EPHB1) detection. Tested with WB, IHC-P in Human.

Synonyms:
Cek 6 antibody, EK6 antibody, ELK antibody, Elkh antibody, EPH receptor B1 antibody, Eph tyrosine kinase 2 antibody, EPH-like kinase 6 antibody, Ephb1 antibody, EPHB1_HUMAN antibody, Ephrin type B receptor 1 antibody, Ephrin type-B receptor 1 antibody, EPHT2 antibody, HEK 6 antibody, HEK6 antibody, NET antibody, Neuronally-expressed EPH-related tyrosine kinase antibody, soluble EPHB1 variant 1 antibody, Tyrosine protein kinase receptor EPH 2 antibody, Tyrosine-protein kinase receptor EPH-2 antibody

Isotype: Rabbit polyclonal IgG

Immunogen:
A synthetic peptide corresponding to a sequence at the N-terminus of human Eph receptor B1 (56-88aa RTYQVCNVFEPNQNNWLLTTFINRRGAHRIYTE), identical to the related mouse and rat sequences.

Form: Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Specificity:
No cross reactivity with other proteins.

Reactivity: Reacts with: human

Applications: WB, IHC-P

Reconstitution:
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.