EREG Picoband polyclonal, anti-human antibody

EREG Picoband polyclonal, anti-human antibody

€270.00
In stock
SKU
AC-ABO12550
Catalog Number: AC-ABO12550
Size: 100 µg
Host: rabbit IgG
Applications: WB
Datasheet

Request Information
Description: Rabbit IgG polyclonal antibody for Tyrosine aminotransferase (TAT) detection. Tested with WB in human, mouse, rat.

Protein Name: Tyrosine aminotransferase

Background:
Transaminase involved in tyrosine breakdown. Converts tyrosine to p-hydroxyphenylpyruvate. Can catalyze the reverse reaction, using glutamic acid, with 2-oxoglutarate as cosubstrate (in vitro). Has much lower affinity and transaminase activity towards phenylalanine. .

Other Names:
Tyrosine aminotransferase, TAT, 2.6.1.5, L-tyrosine:2-oxoglutarate aminotransferase, TAT

Subcellular Localization:

Gene ID: 6898

Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human ATTY (169-208aa FSLYKTLAESMGIEVKLYNLLPEKSWEIDLKQLEYLIDEK), different from the related mouse and rat sequences by two amino acids.

Calculated MW: 50399

Purification: Immunogen affinity purified.

Format: Lyophilized

Contents: Each vial contains 5mg BSA, 0.9 mg NaCl, 0.2mg Na2HPO4, 0.05 mg NaN3.

Concentration (mg/ml): Add 0.2 ml of distilled water will yield a concentration of 500 µg/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.
More Information
Is Featured? No
Write Your Own Review
You're reviewing:EREG Picoband polyclonal, anti-human antibody