ERp57 Picoband polyclonal, anti-human, mouse, rat
€455.00
In stock
SKU
AC-ABO12458
Catalog Number: AC-ABO12458
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB, IHC-P, IHC-F
Datasheet
Request Information
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB, IHC-P, IHC-F
Datasheet
Request Information
Description: Rabbit IgG polyclonal antibody for Protein disulfide-isomerase A3(PDIA3) detection. Tested with WB, IHC-P, IHC-F in Human;Mouse;Rat.Protein Name: Protein disulfide-isomerase A3
Other Names: Protein disulfide-isomerase A3, 5.3.4.1, 58 kDa glucose-regulated protein, 58 kDa microsomal protein, p58, Disulfide isomerase ER-60, Endoplasmic reticulum resident protein 57, ER protein 57, ERp57, Endoplasmic reticulum resident protein 60, ER protein 60, ERp60, PDIA3, ERP57, ERP60, GRP58
Subcellular Localization: Endoplasmic reticulum. Endoplasmic reticulum lumen . Melanosome. Identified by mass spectrometry in melanosome fractions from stage I to stage IV.
Tissue Specificity: Detected in the flagellum and head region of spermatozoa (at protein level). .
Gene ID: 2923
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human ERp57 (471-505aa RELSDFISYLQREATNPPVIQEEKPKKKKKAQEDL), different from the related mouse and rat sequences by two amino acids.
Calculated MW: 56782
Purification: Immunogen affinity purified.
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
Other Names: Protein disulfide-isomerase A3, 5.3.4.1, 58 kDa glucose-regulated protein, 58 kDa microsomal protein, p58, Disulfide isomerase ER-60, Endoplasmic reticulum resident protein 57, ER protein 57, ERp57, Endoplasmic reticulum resident protein 60, ER protein 60, ERp60, PDIA3, ERP57, ERP60, GRP58
Subcellular Localization: Endoplasmic reticulum. Endoplasmic reticulum lumen . Melanosome. Identified by mass spectrometry in melanosome fractions from stage I to stage IV.
Tissue Specificity: Detected in the flagellum and head region of spermatozoa (at protein level). .
Gene ID: 2923
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human ERp57 (471-505aa RELSDFISYLQREATNPPVIQEEKPKKKKKAQEDL), different from the related mouse and rat sequences by two amino acids.
Calculated MW: 56782
Purification: Immunogen affinity purified.
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
| Is Featured? | No |
|---|
Write Your Own Review