ERp57 polyclonal, anti-human, mouse, rat
€384.00
In stock
SKU
ARP-10-P9772
Quantity: 100 µg
Background:
PDIA3 (Protein disulfide isomerase family A, member 3), also called GRP58, Erp57 or ER60, is an isomerase enzyme. It is mapped on 15q15.3. PDIA3 is also part of the major histocompatibility complex (MHC) class I peptide-loading complex, which is essential for formation of the final antigen conformation and export from the endoplasmic reticulum to the cell surface. This gene encodes a protein of the endoplasmic reticulum that interacts with lectin chaperones calreticulin and calnexin to modulate folding of newly synthesized glycoproteins. The protein was once thought to be a phospholipase; however, it has been demonstrated that the protein actually has protein disulfide isomerase activity. It is thought that complexes of lectins and this protein mediate protein folding by promoting formation of disulfide bonds in their glycoprotein substrates.
Description:
Rabbit IgG polyclonal antibody for Protein disulfide-isomerase A3 (PDIA3) detection. Tested with WB, IHC-P in Human, Mouse, Rat.
Synonyms:
58 kDa glucose regulated protein antibody, 58 kDa glucose-regulated protein antibody, 58 kDa microsomal protein antibody, Disulfide isomerase ER 60 antibody, Disulfide isomerase ER-60 antibody, Endoplasmic reticulum resident protein 57 antibody, Endoplasmic reticulum resident protein 60 antibody, ER p57 antibody, ER protein 57 antibody, ER protein 60 antibody, ERp 57 antibody, ERp57 antibody, ERp60 antibody, ERp61 antibody, Glucose Regulated Protein 58 Kd antibody, GRP 57 antibody, GRP 58 antibody, GRP57 antibody, GRP58 antibody, HsT17083 antibody, P58 antibody, PDIA 3 antibody, PDIA3 antibody, PDIA3_HUMAN antibody, Phospholipase C alpha antibody, PI PLC antibody, Protein disulfide isomerase A3 antibody, Protein disulfide isomerase family A member 3 antibody, Protein disulfide-isomerase A3 antibody.
Isotype: Rabbit polyclonal IgG
Immunogen:
A synthetic peptide corresponding to a sequence at the C-terminus of human ERp57 (471-505aa RELSDFISYLQREATNPPVIQEEKPKKKKKAQEDL), different from the related mouse and rat sequences by two amino acids.
Form: Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Specificity:
No cross reactivity with other proteins.
Reactivity: Reacts with: human, mouse, rat
Applications: WB, IHC-P
Reconstitution:
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.
| Is Featured? | No |
|---|
Write Your Own Review