ERV31 polyclonal, anti-human

ERV31 polyclonal, anti-human

€455.00
In stock
SKU
AC-ABO12768
Catalog Number: AC-ABO12768
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB
Datasheet
Request Information
Description: Rabbit IgG polyclonal antibody for Endogenous retrovirus group 3 member 1 Env polyprotein(ERV3-1) detection. Tested with WB in Human.Protein Name: Endogenous retrovirus group 3 member 1 Env polyprotein

Protein Function:
Retroviral envelope proteins mediate receptor recognition and membrane fusion during early infection. Endogenous envelope proteins may have kept, lost or modified their original function during evolution. This endogenous envelope protein has lost its fusogenic properties. It can inhibit cell growth through decrease expression of cyclin B1 and increased expression of p21 in vitro. .

Other Names: Endogenous retrovirus group 3 member 1 Env polyprotein, ERV-3 envelope protein, ERV3 envelope protein, ERV3-1 envelope protein, Envelope polyprotein, HERV-R envelope protein, ERV-R envelope protein, HERV-R_7q21.2 provirus ancestral Env polyprotein, Surface protein, SU, Transmembrane protein, TM, ERV3-1, ERV3

Subcellular Localization: Virion.

Tissue Specificity: Expressed at higher level in adrenal, sebaceous glands and placenta. Expressed at lower level in bone marrow, brain, breast, colon, heart, kidney, liver, lung, ovary, PBL, prostate, skin, spleen, testis, thymus, thyroid, trachea. .

Gene ID: 2086

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human ERV31 (575-604aa LELDDEGKVIKEITAKIQKLAHIPVQTWKG).

Calculated MW: 67942

Purification: Immunogen affinity purified.

Format: Lyophilized

Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
More Information
Is Featured? No
Write Your Own Review
You're reviewing:ERV31 polyclonal, anti-human