ERV31 polyclonal, anti-human

Quantity: 100 µg

Background:
HERV-R_7q21.2 provirus ancestral Env polyprotein, also known as ERV3-1, is a protein that in humans is encoded by the ERV3 gene. By radiation hybrid analysis, the ERV3 gene is mapped to chromosome 7q11.2. The human genome includes many retroelements including the human endogenous retroviruses (HERVs). ERV3, one of the most studied HERVs, is thought to have integrated 30 to 40 million years ago and is present in higher primates with the exception of gorillas. Taken together, the observation of genome conservation, the detection of transcript expression, and the presence of conserved ORFs is circumstantial evidence for a functional role. A functional role is also suggested by the observation that downregulation of ERV3 is reported in choriocarcinoma.

Description:
Rabbit IgG polyclonal antibody for Endogenous retrovirus group 3 member 1 Env polyprotein (ERV3-1) detection. Tested with WB in Human.

Synonyms:
Endogenous retroviral sequence 3 antibody, Endogenous retrovirus group 3 member 1 antibody, ENR1_HUMAN antibody, Envelope polyprotein antibody, envR antibody, ERV R antibody, ERV-3 envelope protein antibody, ERV-R envelope protein antibody, ERV3 1 envelope protein antibody, ERV3 antibody, ERV3 envelope protein antibody, ERV3-1 antibody, ERVR antibody, FLJ23884 antibody, HERV R antibody, HERV-R envelope protein antibody, HERV-R_7q21.2 provirus ancestral Env polyprotein antibody, HERVR antibody, SU antibody, TM antibody, Transmembrane protein antibody

Isotype: Rabbit polyclonal IgG

Immunogen:
A synthetic peptide corresponding to a sequence at the C-terminus of human ERV31 (575-604aa LELDDEGKVIKEITAKIQKLAHIPVQTWKG).

Form: Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Specificity:
No cross reactivity with other proteins.

Reactivity: Reacts with: human

Applications: WB

Reconstitution:
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.