EWSR1 Picoband polyclonal, anti-human, mouse, rat

EWSR1 Picoband polyclonal, anti-human, mouse, rat

€455.00
In stock
SKU
AC-ABO12271
Catalog Number: AC-ABO12271
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB, IHC-P
Datasheet
Request Information
Description: Rabbit IgG polyclonal antibody for RNA-binding protein EWS(EWSR1) detection. Tested with WB, IHC-P in Human;Mouse;Rat.
Protein Name: RNA-binding protein EWS

Protein Function:
Might normally function as a transcriptionnal repressor. EWS-fusion-proteins (EFPS) may play a role in the tumorigenic process. They may disturb gene expression by mimicking, or interfering with the normal function of CTD-POLII within the transcription initiation complex. They may also contribute to an aberrant activation of the fusion protein target genes.

Other Names: RNA-binding protein EWS, EWS oncogene, Ewing sarcoma breakpoint region 1 protein, EWSR1, EWS

Subcellular Localization: Nucleus . Cytoplasm . Cell membrane . Relocates from cytoplasm to ribosomes upon PTK2B/FAK2 activation.

Tissue Specificity: Ubiquitous.

Gene ID: 2130

Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human EWSR1 (369-399aa NDSVTLDDLADFFKQCGVVKMNKRTGQPMIH), different from the related mouse sequence by one amino acid.

Calculated MW: 68478

Purification: Immunogen affinity purified.

Format: Lyophilized

Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
More Information
Is Featured? No
Write Your Own Review
You're reviewing:EWSR1 Picoband polyclonal, anti-human, mouse, rat