EWSR1 polyclonal, anti-human, mouse, rat

Quantity: 100 µg

Background:
This gene encodes a multifunctional protein that is involved in various cellular processes, including gene expression, cell signaling, and RNA processing and transport. The protein includes an N-terminal transcriptional activation domain and a C-terminal RNA-binding domain. Chromosomal translocations between this gene and various genes encoding transcription factors result in the production of chimeric proteins that are involved in tumorigenesis. These chimeric proteins usually consist of the N-terminal transcriptional activation domain of this protein fused to the C-terminal DNA-binding domain of the transcription factor protein. Mutations in this gene, specifically a t(11;22)(q24;q12) translocation, are known to cause Ewing sarcoma as well as neuroectodermal and various other tumors. Alternative splicing of this gene results in multiple transcript variants. Related pseudogenes have been identified on chromosomes 1 and 14.

Description:
Rabbit IgG polyclonal antibody for RNA-binding protein EWS (EWSR1) detection. Tested with WB, IHC-P in Human, Mouse, Rat.

Synonyms:
bK984G1.4 antibody, bK984G1.4 Ewing sarcoma breakpoint region 1 protein antibody, Ewing sarcoma breakpoint region 1 antibody, Ewing sarcoma breakpoint region 1 protein antibody, Ewings sarcoma EWS Fli1 type 1 oncogene antibody, EWS antibody, EWS oncogene antibody, EWS RNA binding protein 1 antibody, EWS_HUMAN antibody, EWSR 1 antibody, Ewsr1 antibody, EWSR1 protein antibody, RNA binding protein EWS antibody, RNA-binding protein EWS antibody.

Isotype: Rabbit polyclonal IgG

Immunogen:
A synthetic peptide corresponding to a sequence in the middle region of human EWSR1 (369-399aa NDSVTLDDLADFFKQCGVVKMNKRTGQPMIH), different from the related mouse sequence by one amino acid.A synthetic peptide corresponding to a sequence in the middle region of human EWSR1 (369-399aa NDSVTLDDLADFFKQCGVVKMNKRTGQPMIH), different from the related mouse sequence by one amino acid.

Form: Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Specificity:
No cross reactivity with other proteins.

Reactivity: Reacts with: human, mouse, rat

Applications: WB, IHC-P

Reconstitution:
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.