FABP2/I-FABP Picoband polyclonal, anti-human, mouse, rat

Description: Rabbit IgG polyclonal antibody for Fatty acid-binding protein, intestinal(FABP2) detection. Tested with WB, IHC-P in Human;Mouse;Rat.Protein Name: Fatty acid-binding protein, intestinal

Protein Function:
FABP are thought to play a role in the intracellular transport of long-chain fatty acids and their acyl-CoA esters. FABP2 is probably involved in triglyceride-rich lipoprotein synthesis. Binds saturated long-chain fatty acids with a high affinity, but binds with a lower affinity to unsaturated long- chain fatty acids. FABP2 may also help maintain energy homeostasis by functioning as a lipid sensor.

Other Names: Fatty acid-binding protein, intestinal, Fatty acid-binding protein 2, Intestinal-type fatty acid-binding protein, I-FABP, FABP2, FABPI

Subcellular Localization: Cytoplasm.

Tissue Specificity: Expressed in the small intestine and at much lower levels in the large intestine. Highest expression levels in the jejunum. .

Gene ID: 2169

Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human FABP2/I-FABP (2-38aa AFDSTWKVDRSENYDKFMEKMGVNIVKRKLAAHDNLK), different from the related mouse sequence by seven amino acids, and from the related rat sequence by six amino acids

Calculated MW: 15237

Purification: Immunogen affinity purified.

Format: Lyophilized

Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.