FABP4 polyclonal, anti-human, mouse, rat

FABP4 polyclonal, anti-human, mouse, rat

€354.00
In stock
SKU
ARP-10-R1085
Catalog Number: 10-R1085
Isotype: rabbit polyclonal IgG

Information
Questions? Contact us!


Quantity: 100 µg

Background:
Fatty acid binding proteins (FABPs) are small cytoplasmic proteins that are expressed in a highly tissue-specific manner and bind to fatty acids such as oleic and retinoic acid. Adipocyte fatty-acid-binding protein, aP2 (FABP4) is expressed in adipocytes and macrophages, and integrates inflammatory and metabolic responses. Studies in aP2-deficient mice have shown that this lipid chaperone has a significant role in several aspects of metabolic syndrome, including type 2 diabetes and atherosclerosis. It regulates allergic airway inflammation and may provide a link between fatty acid metabolism and asthma.

Description:
Rabbit IgG polyclonal antibody for Fatty acid-binding protein, adipocyte (FABP4) detection. Tested with WB, IHC-P in Human, Mouse, Rat.

Synonyms:
3T3-L1 lipid-binding protein antibody, 422/aP2 antibody, A FABP antibody, A-FABP antibody, adipocyte antibody, Adipocyte lipid binding protein antibody, Adipocyte lipid-binding protein antibody, Adipocyte protein AP2 antibody, Adipocyte-type fatty acid-binding protein antibody, AFABP antibody, ALBP antibody, ALBP/Ap2 antibody, aP2 antibody, FABP antibody, FABP4 antibody, FABP4_HUMAN antibody, Fatty acid binding protein 4 adipocyte antibody, Fatty acid binding protein 4 antibody, Fatty acid binding protein adipocyte antibody, Fatty acid-binding protein 4 antibody, Fatty acid-binding protein antibody, Lbpl antibody, Myelin P2 protein homolog antibody, P15 antibody, P2 adipocyte protein antibody, Protein 422 antibody.

Isotype: Rabbit polyclonal IgG

Immunogen:
A synthetic peptide corresponding to a sequence at the N-terminus of human FABP4 (10-40aa KLVSSENFDDYMKEVGVGFATRKVAGMAKPN), identical to the related mouse and rat sequences.A synthetic peptide corresponding to a sequence at the N-terminus of human FABP4 (10-40aa KLVSSENFDDYMKEVGVGFATRKVAGMAKPN), identical to the related mouse and rat sequences.

Form: Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Specificity:
No cross reactivity with other proteins.

Reactivity: Reacts with: mouse, rat.
Predicted to work with: human.

Applications: WB, IHC-P

Reconstitution:
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.
More Information
Is Featured? No
Write Your Own Review
You're reviewing:FABP4 polyclonal, anti-human, mouse, rat