Fascin polyclonal, anti-human, rat

Quantity: 100 µg

Background:
Fascin is an actin cross-linking protein. The Fascin gene contains 5 exons and spans 7 kb. It is a 54-58 kilodalton monomeric actin filament bundling protein originally isolated from sea urchin egg but also found in Drosophila and vertebrates, including humans. Fascin (from the Latin for bundle) is spaced at 11 nanometre intervals along the filament. The bundles in cross section are seen to be hexagonally packed, and the longitudinal spacing is compatible with a model where fascin cross-links at alternating 4 and 5 actins. It is calcium insensitive and monomeric. Fascin binds beta-catenin, and colocalizes with it at the leading edges and borders of epithelial and endothelial cells. The role of Fascin in regulating cytoskeletal structures for the maintenance of cell adhesion, coordinating motility and invasion through interactions with signalling pathways is an active area of research especially from the cancer biology perspective. Abnormal fascin expression or function has been implicated in breast cancer, colon cancer, esophageal squamous cell carcinoma, gallbladder cancer and prostate cancer.

Description:
Rabbit IgG polyclonal antibody for Fascin (FSCN1) detection. Tested with WB in Human, Rat.

Synonyms:
55 kDa actin bundling protein antibody, 55 kDa actin-bundling protein antibody, Actin bundling protein antibody, actin bundling protein, 55-KD antibody, FAN 1 antibody, FAN1 antibody, Fascin 1 antibody, Fascin antibody, Fascin homolog 1 actin bundling protein (Strongylocentrotus purpuratus) antibody, Fascin homolog 1 antibody, Fascin, sea urchin, homolog of, 1 antibody, Fascin1 antibody, FLJ38511 antibody, FSCN 1 antibody, FSCN1 antibody, FSCN1_HUMAN antibody, HSN antibody, p55 antibody, Singed (Drosophila) like (sea urchin fascin homolog like) antibody, Singed drosophila homolog like antibody, Singed like (fascin homolog sea urchin) (Drosophila) antibody, Singed like (fascin homolog sea urchin) antibody, Singed like protein antibody, Singed, drosophila, homolog of antibody, Singed-like protein antibody, SNL antibody, Strongylocentrotus purpuratus antibody

Isotype: Rabbit polyclonal IgG

Immunogen:
A synthetic peptide corresponding to a sequence at the N-terminus of human Fascin (42-73aa KKQIWTLEQPPDEAGSAAVCLRSHLGRYLAAD), identical to the related mouse sequence, and different from the related rat sequence by one amino acid.A synthetic peptide corresponding to a sequence at the N-terminus of human Fascin (42-73aa KKQIWTLEQPPDEAGSAAVCLRSHLGRYLAAD), identical to the related mouse sequence, and different from the related rat sequence by one amino acid.

Form: Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Specificity:
No cross reactivity with other proteins.

Reactivity: Reacts with: human, rat

Applications: WB

Reconstitution:
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.