FDCSP Picoband polyclonal, anti-human
€455.00
In stock
SKU
AC-ABO10350
Catalog Number: AC-ABO10350
Size: 100 µg
Isotype: Rabbit IgG
Applications: IHC-P
Datasheet
Request Information
Size: 100 µg
Isotype: Rabbit IgG
Applications: IHC-P
Datasheet
Request Information
Description: Rabbit IgG polyclonal antibody for Follicular dendritic cell secreted peptide(FDCSP) detection. Tested with IHC-P in Human.Protein Name: Follicular dendritic cell secreted peptide
Protein Function:
Can bind to the surface of B-lymphoma cells, but not T- lymphoma cells, consistent with a function as a secreted mediator acting upon B-cells.
Other Names: Follicular dendritic cell secreted peptide, FDC secreted protein, FDC-SP, FDCSP, C4orf7
Subcellular Localization: Secreted.
Tissue Specificity: Abundantly expressed in tonsil, lymph node, and trachea; strong expression in prostate; lower expression in thyroid, stomach, and colon. .
Gene ID: 260436
Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human FDCSP (18-51aa FPVSQDQEREKRSISDSDELASGFFVFPYPYPFR).
Calculated MW: 9700
Purification: Immunogen affinity purified.
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
Protein Function:
Can bind to the surface of B-lymphoma cells, but not T- lymphoma cells, consistent with a function as a secreted mediator acting upon B-cells.
Other Names: Follicular dendritic cell secreted peptide, FDC secreted protein, FDC-SP, FDCSP, C4orf7
Subcellular Localization: Secreted.
Tissue Specificity: Abundantly expressed in tonsil, lymph node, and trachea; strong expression in prostate; lower expression in thyroid, stomach, and colon. .
Gene ID: 260436
Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human FDCSP (18-51aa FPVSQDQEREKRSISDSDELASGFFVFPYPYPFR).
Calculated MW: 9700
Purification: Immunogen affinity purified.
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
| Is Featured? | No |
|---|
Write Your Own Review