FE65 polyclonal, anti-human, mouse, rat

Quantity: 100 µg

Background:
APBB1 is also known as RIR or FE65. The protein encoded by this gene is a member of the Fe65 protein family. It is an adaptor protein localized in the nucleus. It interacts with the Alzheimer's disease amyloid precursor protein (APP), transcription factor CP2/LSF/LBP1 and the low-density lipoprotein receptor-related protein. APP functions as a cytosolic anchoring site that can prevent the gene product's nuclear translocation. This encoded protein could play an important role in the pathogenesis of Alzheimer's disease. It is thought to regulate transcription. Also it is observed to block cell cycle progression by downregulating thymidylate synthase expression. Multiple alternatively spliced transcript variants encoding different isoforms have been described for this gene.

Description:
Rabbit IgG polyclonal antibody for Amyloid beta A4 precursor protein-binding family B member 1 (APBB1) detection. Tested with WB, IHC-P in Human, Mouse, Rat.

Synonyms:
Adaptor protein FE65a2 antibody, Amyloid beta (A4) precursor protein binding family B member 1 antibody, Amyloid Beta A4 Precursor Protein Binding Family B antibody, Amyloid beta A4 precursor protein binding family B member 1 antibody, Amyloid beta A4 precursor protein-binding family B member 1 antibody, Amyloid beta precursor protein binding family B member 1 antibody, APBB 1 antibody, APBB1 antibody, APBB1_HUMAN antibody, FE 65 antibody, Fe65 protein antibody, Protein Fe65 antibody, RIR antibody, stat like protein antibody

Isotype: Rabbit polyclonal IgG

Immunogen:
A synthetic peptide corresponding to a sequence at the N-terminus of human FE65 (21-56aa ALSLPLPLHAAHNQLLNAKLQATAVGPKDLRSAMGE), different from the related mouse sequence by two amino acids, and from the related rat sequence by three amino acids.

Form: Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Specificity:
No cross reactivity with other proteins.

Reactivity: Reacts with: human, mouse, rat

Applications: WB, IHC-P

Reconstitution:
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.