FMO1 Picoband polyclonal, anti-human, mouse, rat

FMO1 Picoband polyclonal, anti-human, mouse, rat

€455.00
In stock
SKU
AC-ABO12275
Catalog Number: AC-ABO12275
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB
Datasheet
Request Information
Description: Rabbit IgG polyclonal antibody for Dimethylaniline monooxygenase [N-oxide-forming] 1(FMO1) detection. Tested with WB in Human;Mouse;Rat.
Protein Name: Dimethylaniline monooxygenase [N-oxide-forming] 1

Protein Function:
This protein is involved in the oxidative metabolism of a variety of xenobiotics such as drugs and pesticides. Form I catalyzes the N-oxygenation of secondary and tertiary amines.

Other Names: Dimethylaniline monooxygenase [N-oxide-forming] 1, 1.14.13.8, Dimethylaniline oxidase 1, Fetal hepatic flavin-containing monooxygenase 1, FMO 1, FMO1

Subcellular Localization: Microsome membrane. Endoplasmic reticulum membrane.

Tissue Specificity: Expressed mainly in fetal liver, adult kidney and, to a lesser extent, the intestine.

Gene ID: 2326

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human FMO1 (334-363aa AFPFLDESVVKVEDGQASLYKYIFPAHLQK), different from the related mouse sequence by one amino acid, and from the related rat sequence by two amino acids.

Calculated MW: 60311

Purification: Immunogen affinity purified.

Format: Lyophilized

Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
More Information
Is Featured? No
Write Your Own Review
You're reviewing:FMO1 Picoband polyclonal, anti-human, mouse, rat