FMO1 Picoband polyclonal, anti-human, mouse, rat
€455.00
In stock
SKU
AC-ABO12275
Catalog Number: AC-ABO12275
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB
Datasheet
Request Information
Size: 100 µg
Isotype: Rabbit IgG
Applications: WB
Datasheet
Request Information
Description: Rabbit IgG polyclonal antibody for Dimethylaniline monooxygenase [N-oxide-forming] 1(FMO1) detection. Tested with WB in Human;Mouse;Rat.
Protein Name: Dimethylaniline monooxygenase [N-oxide-forming] 1
Protein Function:
This protein is involved in the oxidative metabolism of a variety of xenobiotics such as drugs and pesticides. Form I catalyzes the N-oxygenation of secondary and tertiary amines.
Other Names: Dimethylaniline monooxygenase [N-oxide-forming] 1, 1.14.13.8, Dimethylaniline oxidase 1, Fetal hepatic flavin-containing monooxygenase 1, FMO 1, FMO1
Subcellular Localization: Microsome membrane. Endoplasmic reticulum membrane.
Tissue Specificity: Expressed mainly in fetal liver, adult kidney and, to a lesser extent, the intestine.
Gene ID: 2326
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human FMO1 (334-363aa AFPFLDESVVKVEDGQASLYKYIFPAHLQK), different from the related mouse sequence by one amino acid, and from the related rat sequence by two amino acids.
Calculated MW: 60311
Purification: Immunogen affinity purified.
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
Protein Name: Dimethylaniline monooxygenase [N-oxide-forming] 1
Protein Function:
This protein is involved in the oxidative metabolism of a variety of xenobiotics such as drugs and pesticides. Form I catalyzes the N-oxygenation of secondary and tertiary amines.
Other Names: Dimethylaniline monooxygenase [N-oxide-forming] 1, 1.14.13.8, Dimethylaniline oxidase 1, Fetal hepatic flavin-containing monooxygenase 1, FMO 1, FMO1
Subcellular Localization: Microsome membrane. Endoplasmic reticulum membrane.
Tissue Specificity: Expressed mainly in fetal liver, adult kidney and, to a lesser extent, the intestine.
Gene ID: 2326
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human FMO1 (334-363aa AFPFLDESVVKVEDGQASLYKYIFPAHLQK), different from the related mouse sequence by one amino acid, and from the related rat sequence by two amino acids.
Calculated MW: 60311
Purification: Immunogen affinity purified.
Format: Lyophilized
Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Concentration (mg/ml): Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time.Avoid repeated freezing and thawing.
| Is Featured? | No |
|---|
Write Your Own Review