FMO1 polyclonal, anti-human, mouse, rat

Quantity: 100 µg

Background:
Metabolic N-oxidation of the diet-derived amino-trimethylamine (TMA) is mediated by flavin-containing monooxygenase and is subject to an inherited FMO3 polymorphism in man resulting in a small subpopulation with reduced TMA N-oxidation capacity resulting in fish odor syndrome Trimethylaminuria. Three forms of the enzyme, FMO1 found in fetal liver, FMO2 found in adult liver, and FMO3 are encoded by genes clustered in the 1q23-q25 region. Flavin-containing monooxygenases are NADPH-dependent flavoenzymes that catalyzes the oxidation of soft nucleophilic heteroatom centers in drugs, pesticides, and xenobiotics. Several transcript variants encoding different isoforms have been found for this gene.

Description:
Rabbit IgG polyclonal antibody for Dimethylaniline monooxygenase [N-oxide-forming] 1 (FMO1) detection. Tested with WB in Human, Mouse, Rat.

Synonyms:
Dimethylaniline monooxygenase [N oxide forming] 1 antibody, Dimethylaniline monooxygenase [N-oxide-forming] 1 antibody, Dimethylaniline oxidase 1 antibody, Fetal hepatic flavin containing monooxygenase 1 antibody, Fetal hepatic flavin-containing monooxygenase 1 antibody, Flavin containing monooxygenase 1 (fetal liver) antibody, Flavin Containing Monooxygenase 1 antibody, FMO 1 antibody, FMO1 antibody, FMO1_HUMAN antibody, OTTHUMP00000033536 antibody, OTTHUMP00000033537 antibody

Isotype: Rabbit polyclonal IgG

Immunogen:
A synthetic peptide corresponding to a sequence at the C-terminus of human FMO1 (334-363aa AFPFLDESVVKVEDGQASLYKYIFPAHLQK), different from the related mouse sequence by one amino acid, and from the related rat sequence by two amino acids.

Form: Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Specificity:
No cross reactivity with other proteins.

Reactivity: Reacts with: human, mouse, rat

Applications: WB

Reconstitution:
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage: At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.